KEGG   Corynebacterium efficiens: CE2082Help
Entry
CE2082            CDS       T00103                                 

Definition
(GenBank) cytochrome b of bc1 complex
  KO
K03891  ubiquinol-cytochrome c reductase cytochrome b subunit
Organism
cef  Corynebacterium efficiens
Pathway
cef00190  Oxidative phosphorylation
cef01100  Metabolic pathways
Module
cef_M00151  Cytochrome bc1 complex respiratory unit
Brite
KEGG Orthology (KO) [BR:cef00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    CE2082
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_B_N_2 Cytochrome_B Ilm1
Motif
Other DBs
NCBI-ProteinID: BAC18892
NITE: CE2082
UniProt: Q8FNR2
Position
complement(2210357..2211982)
Genome map
AA seq 541 aa AA seqDB search
MSNKLATVGNNLDSRYTMAGGIRRQINKVFPTHWSFLLGEIALYSFIILILTGVYLTLFF
DPSITKVIYDGAYLPLNGVEMSRAYMTALDISFEVRGGLFVRQMHHWAALMFVVSMMVHM
MRIFFTGAFRRPREANWVIGVVLLILGIAEGFMGYSLPDDLLSGVGLRIMSAIIVGLPII
GTWMHWMIFGGDFPSDIMLDRFYIAHVLIIPGIILGLIAAHLALVWYQKHTQFPGAGRTE
NNVIGIRIMPVFAVKSVAFGAITLGFLSLLAGVTTINAIWNLGPYNPSQVSAGSQPDIYM
LWTDGAARVMPAWELYFGNYTVPAVFWVAIMLGILVVLLIAYPWIEKKLTGDDAHHNLLQ
RPRDVPVRTSLGVMALIFYILLTISGGNDIWAYQFDVSLNAMTWIGRIGLIVFPAIGYFV
TYRLCIGLQRSDREVLEHGIETGVIKQMPNGAFIEVHQPLGPVDEHGHPIPLPYSGAKVP
KQLNELGFAEVESRGGFFGPDPESVATKANEIAHANHLEEVATLAAIQEENRKRDQAEGR
I
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgagtaacaaactagctacagtgggaaacaatcttgattctcgctacaccatggccggt
ggtatccgccgccagattaataaggtcttcccgacccactggtccttcctcctgggtgag
atcgctctctacagcttcatcatcctgatcctgaccggtgtctacctgacgctgttcttc
gatccttcgatcaccaaggtcatctacgacggtgcctacctccccctcaacggtgtggag
atgtcccgtgcctacatgaccgctctcgatatctccttcgaggtccgtggtggactgttc
gtacgtcagatgcaccactgggctgcgctgatgttcgtggtctccatgatggtccacatg
atgcgcatcttcttcaccggtgcgttccgtcgcccgcgtgaagccaactgggtcattggt
gtcgtcctcctgatcctgggcatcgctgaaggcttcatgggttactccctgcctgatgac
ctgctctccggtgtcggtctgcgaatcatgtccgcgatcatcgtgggtctgccgatcatc
ggtacctggatgcactggatgatcttcggtggggacttcccgtcggacatcatgctcgac
cgtttctacatcgcgcacgtcctgatcatcccgggcatcatcctcggcctgatcgccgcc
catctagctctggtctggtaccagaagcacacccagttcccgggtgctggccgcaccgag
aacaacgtgatcggcatccgtattatgccggtcttcgcggtcaagtccgttgccttcgga
gcgatcaccctcggcttcctctccctgcttgctggtgtcaccaccatcaacgcgatctgg
aacctgggcccgtacaacccgtctcaggtctccgctggttcccagccggatatctacatg
ctgtggacagatggtgcggcccgtgtcatgccggcatgggagctctacttcggtaactac
accgttcccgctgtcttctgggttgcgatcatgctgggtatcctcgtggtcctgctcatc
gcctacccgtggattgagaagaagctgaccggtgacgatgcgcaccacaacctgctgcag
cgtcctcgcgatgtgccggtccgcacctccctcggtgtcatggcactgatcttctacatc
ctcctgaccatctcgggtggtaacgatatctgggcataccagttcgatgtgtccctgaat
gccatgacctggatcggccgtatcggtctgatcgtcttcccggccatcggttactttgtc
acctaccgtctgtgcatcggtctgcagcgctccgaccgtgaggttctggagcatggcatt
gagaccggtgtgatcaagcagatgcctaacggcgcgttcattgaggtccaccagccactc
ggcccggttgacgagcacggccacccaatcccactgccatacagtggtgcgaaggtgccg
aagcagctcaacgagctcgggttcgctgaagttgagtcccgtggtggattcttcggacca
gatccggagtccgtcgccactaaggccaacgaaatcgctcacgccaatcacctggaggag
gtagccaccctggctgccatccaggaggagaatcgtaagcgtgaccaggcggagggacgg
atttaa

DBGET integrated database retrieval system