KEGG   Corynebacterium efficiens: CE2451Help
Entry
CE2451            CDS       T00103                                 

Definition
(GenBank) putative succinyl-CoA synthetase beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
cef  Corynebacterium efficiens
Pathway
cef00020  Citrate cycle (TCA cycle)
cef00640  Propanoate metabolism
cef00660  C5-Branched dibasic acid metabolism
cef01100  Metabolic pathways
cef01110  Biosynthesis of secondary metabolites
cef01120  Microbial metabolism in diverse environments
cef01130  Biosynthesis of antibiotics
cef01200  Carbon metabolism
Module
cef_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cef_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cef00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CE2451
   00640 Propanoate metabolism
    CE2451
   00660 C5-Branched dibasic acid metabolism
    CE2451
Enzymes [BR:cef01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     CE2451
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 CPSase_L_D2 GARS_A ATP-grasp
Motif
Other DBs
NCBI-ProteinID: BAC19260
NITE: CE2451
UniProt: Q8FMQ3
Position
complement(2607486..2608763)
Genome map
AA seq 425 aa AA seqDB search
MQVWCPASAGPGWPHPPHTLSRTEDIMDLFEYQARDLFEAHGVPVVRGIVADTPEDARRA
AEELGGPTVVKAQVKVGGRGKAGGVRLAGDPQKAQEAAGAILSMDIKGHTVEQVMVVEAV
DIAEEYYFSILLDRANRSYLAMCSMEGGMEIEVLARERPEALARVEVNPLTGIDDTKARE
IARAAGFDDTIAQKIVPVLQQLYRVYHDEDATLVEVNPLVLTAEGEVLALDGKITLDDNA
DFRHDNREELVGSAGTTDPLELRAKKNGLNYVRLDGTVGIIGNGAGLVMSTLDIVAEAGQ
RHGGQAPANFLDIGGGASSDSMVAGLEVIMCDPQVRSVLVNVFGGITACDEVARGIVGAL
EELGDGAAKPIVVRLDGHNVDKGREILEEFNHPLVTLVAGMDEAADRAAQLAAEQPTTEF
ATVTS
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
ttgcaagtgtggtgcccggcatcggcaggccccgggtggccgcatccaccgcacaccctg
tcgaggacggaagacatcatggatctctttgaataccaggcccgtgatctctttgaagcc
catggcgtgcccgtggtgcgtggtattgtggccgacaccccggaggatgcccgtcgggcc
gctgaggaactcggtggtcccacggtggtcaaggcccaggtgaaggtcgggggccgcggt
aaagccggcggtgtgcgactggccggggatccgcagaaggcccaggaggctgccggggcg
atcctgagcatggacatcaaggggcacaccgtcgaacaggtcatggtggtggaggcggtg
gatatcgccgaggagtactacttctccatcctcctggatcgcgccaaccgttcctacctg
gccatgtgctccatggagggcggcatggagattgaagtgctggccagggaacgccccgag
gccctggcccgtgtggaggtgaacccactgaccggcatcgacgataccaaggcccgggag
atcgcccgggccgcaggtttcgacgacaccatcgcgcagaagatcgtcccggtcctgcag
cagctctaccgggtctaccacgatgaggatgccacgctcgtcgaggtgaaccccctggtg
ctcaccgcggagggggaggtcctggcgctggacgggaagatcaccctggacgacaatgcc
gatttccgccatgacaaccgggaggaactggtgggatcagctggaaccacggacccgctg
gagctcagggccaagaagaacgggcttaattatgtgaggttggatggcaccgtcgggatc
atcggcaatggtgccggtctggtgatgtccacgctcgacatcgtggccgaggccggccag
agacacggtggacaggcacctgcgaatttcctcgatatcggagggggagcctcctctgac
agtatggtggcgggactggaggtgattatgtgcgatccgcaggtccgcagcgtgctggtc
aacgtcttcggtggcatcactgcctgcgacgaggtggccaggggcatcgtcggtgctctg
gaggagcttggggacggggcggcgaagccgattgtcgtccgtctggatggccacaatgtg
gacaaggggcgggagatcctggaggagttcaaccacccactggtcactctcgtcgcggga
atggatgaagccgccgaccgggcagcccagctcgccgcggaacagcccaccaccgaattt
gccaccgtcaccagctag

DBGET integrated database retrieval system