KEGG   Corynebacterium efficiens: CE2838Help
Entry
CE2838            CDS       T00103                                 

Definition
(GenBank) putative oxidoreductase
Organism
cef  Corynebacterium efficiens
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N_2 ADH_zinc_N ADH_N NAD_binding_10
Motif
Other DBs
NCBI-ProteinID: BAC19648
NITE: CE2838
UniProt: Q8FLN0
Position
complement(3018726..3019727)
Genome map
AA seq 333 aa AA seqDB search
MTELPHTMPAVGLVDSLPTDHPDFLIDVEVPRPDPGPRDLLVEIAAVSINPVDTKVRMRV
GKQDTPKILGYDAAGTVVAVGSGVSLFRPGDTVFYAGSNQRQGTNARFHLVDERLVGHAP
GSVDATHAAALPLVFLTAWEALFDRLPVTQSTTGTLLVLGGAGGVPSALIQLARALTNLR
VVATASRPESTRWVREMGAHDVIDHHHDLREQISGVDFVFSSWTTGREEELTAVMSPQSH
LVLIDDPLNPNLGAFKQKSIAVHWEFMFTRAMFATPDMAVQGQILTKIADMIDRGQLRSI
TDRVLTGMTAETLMEGHRLIEEGHTTGKIVVKV
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgactgaactcccccacaccatgcccgcggtcgggctggttgattccctgcccaccgac
cacccggatttcctcatcgacgtggaggtcccccgccccgatccgggaccccgtgatcta
ttggtggagatcgccgcggtgtccatcaacccggtggacacgaaggtacgcatgcgcgtc
ggcaagcaggacaccccgaagatcctgggctatgacgccgccggaaccgtcgtcgcggtc
ggttccggggtctccctcttccgccccggtgacaccgtgttctatgccggatccaatcag
cgccagggcaccaacgcccggttccacctcgtcgatgagcgcctcgtcggccacgcgccg
ggcagcgtggatgccacccacgccgccgccctgcccctggtcttcctgaccgcctgggag
gccctgttcgaccggctgccggtcacccagtccaccaccggcaccctgctggtgctgggc
ggtgccggaggtgtgccgtctgcgctcatccagctggcccgggccctgaccaacctgcgg
gtggtggccaccgcctcacgcccggaatccacccgctgggtgcgcgagatgggtgcccac
gatgtcattgatcaccaccatgatctgcgggagcagatcagcggggtggacttcgtcttc
agttcctggaccaccgggcgcgaggaggaactcaccgcggtgatgtcaccgcagtcgcac
ctggtgcttatcgacgatcccctcaaccccaacctcggtgccttcaaacagaaatccatc
gccgtgcactgggagttcatgttcacccgcgccatgttcgccacccccgacatggcggtg
cagggacagatcctcaccaagatcgccgacatgatcgaccgcggacagctccgctccatc
accgaccgggtcctcaccggaatgaccgccgagaccctcatggagggccaccgcctcatc
gaagagggacacaccaccggcaagatcgtcgtgaaagtgtag

DBGET integrated database retrieval system