KEGG   Corynebacterium efficiens: CE2872Help
Entry
CE2872            CDS       T00103                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cef  Corynebacterium efficiens
Pathway
cef00260  Glycine, serine and threonine metabolism
cef00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cef01100  Metabolic pathways
cef01110  Biosynthesis of secondary metabolites
cef01130  Biosynthesis of antibiotics
cef01230  Biosynthesis of amino acids
Module
cef_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cef00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CE2872 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CE2872 (trpB)
Enzymes [BR:cef01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CE2872 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: BAC19682
NITE: CE2872
UniProt: Q8FLJ6
Position
3057622..3058878
Genome map
AA seq 418 aa AA seqDB search
MTDNKNLGGSTLLPAYFGEFGGQFVAESLLPALDQLEKAFVDATNHPEFRQELAAYLRDY
LGRPTPLTECSNLPLPGQGRGYARIFLKREDLVHGGAHKTNQVIGQALLAKRMGKTRIIA
ETGAGQHGTATALACSLLGLECVVYMGAKDVARQQPNVYRMQLHGAKVIPVESGSGTLKD
AVNEALRDWTATFHESHYLLGTAAGPHPFPTIVREFHKVISEEAKAQMLERTGKMPDVVV
ACVGGGSNAIGMFADFIDEEGVELVGAEPAGEGLDSGKHGATITNGQIGILHGTRSFLMR
SSDGQVEESYSISAGLDYPGVGPQHAHLHSTGRATYVGITDAEALIAFQYLARYEGIIAA
LESSHALAYALKRAKLAEEEGKQITILVSLSGRGDKDVDHIRRTLEEKPELILKEEER
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgactgacaacaagaacctcggcggcagcacgctgttgcccgcctacttcggtgagttc
ggtggacagttcgtcgccgagtcactcctgcccgcgctggatcagttggagaaggccttc
gtcgatgccaccaaccatcctgagttccgtcaggagctcgccgcctacctccgcgactac
ctcggtcgcccgaccccgctgaccgaatgctccaacctgccgctgccggggcaggggagg
ggttatgcgcgcatcttcttgaagcgcgaggatctcgtgcacggcggtgcccacaagacc
aaccaggtgatcggtcaggcactgctggccaagcgcatgggcaagacgcgcatcatcgcc
gagaccggtgccggccagcacggcaccgccaccgctctcgcgtgctccctcctcggcctg
gagtgcgtggtctacatgggtgccaaggacgtcgcccgccagcagcccaacgtctaccgc
atgcagctgcacggcgcgaaggtgatccccgtggagtccggttccggcaccctcaaggac
gccgtgaatgaggcgctgcgcgactggaccgccaccttccacgagtcccactacctcctg
ggcaccgccgccggaccgcacccgttcccgacgatcgtgcgcgaattccacaaggtgatc
tccgaggaggccaaggcgcagatgctcgagcgcaccggcaagatgccggatgtcgtcgtc
gcctgcgtcggcggtggctccaatgccatcggcatgttcgcggacttcatcgatgaggag
ggcgtggaactggtcggcgccgagcccgccggggagggcctggattccggcaagcacgga
gccacaatcaccaatggacagatcggcatcctgcacggcacccggtccttcctcatgcgc
agttccgacggacaggtggaggagtcctattccatctccgccgggctggactatcccggg
gtgggcccgcagcacgcccacctccactcaaccggtcgcgccacctatgtcggtatcacc
gacgccgaggcgctcatagcgttccagtacctggcacgctatgagggcatcatcgctgcc
ctggagtcctcccacgctctggcctatgcgctcaagcgcgcaaagctcgccgaggaggag
ggcaagcagatcaccatcctggtgtcgctgtccggccgtggcgacaaggacgtcgaccac
atccgtagaaccctggaagaaaagccggaactgatcctcaaggaggaggagcgctag

DBGET integrated database retrieval system