KEGG   Celeribacter ethanolicus: CEW89_00405Help
Entry
CEW89_00405       CDS       T05094                                 

Definition
(GenBank) aldehyde dehydrogenase (NADP(+))
  KO
K13877  2,5-dioxopentanoate dehydrogenase [EC:1.2.1.26]
Organism
ceh  Celeribacter ethanolicus
Pathway
ceh00040  Pentose and glucuronate interconversions
ceh00053  Ascorbate and aldarate metabolism
ceh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ceh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CEW89_00405
   00053 Ascorbate and aldarate metabolism
    CEW89_00405
Enzymes [BR:ceh01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.26  2,5-dioxovalerate dehydrogenase
     CEW89_00405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ATG46165
UniProt: A0A291G7N2
Position
86201..87715
Genome map
AA seq 504 aa AA seqDB search
MTFTPHGKHLIAGAWVAGAESFTSTPTTGEGQSFSKGTPALVDQAVQAAEDAFWTYGYTT
REERAAFLETIAAEIEARADLITPTAMAESGLPEARLVGERERTTGQLKLFADHIRKGDY
LDRRHDEALPNRAPLPRPDLRLMQRPIGPVAVFGASNFPLAFSVAGGDTASALAAGCPVV
VKGHEAHPATSEIVADAFKAAIETCGLPAGVFSMVHGGAHKVGAALVQHHLINAVGFTGS
LAGGRALFDLCAKRVNPIPFFGELGSVNPMFLLPEALSARGEELGKGWAGSLAMGAGQFC
TNPGIVVVIEGAEEEAFTKAALAALTATGSQVMLTEGIASAYVKGGAKIKTQPGVQELLT
QMCDRREAKPFLFKVKAEDWLTNETLSEEVFGPLGLIVTVKDAAQMIEVAKSFEGQLTAT
LHMDEADMALAGQLMPILERKAGRVMANGFPTGVEVCDSMVHGGPYPASTNFGATSVGTM
AIRRFLRPVCYQNIPSAVLPLDLV
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgacattcaccccgcatgggaaacatttgattgcaggcgcatgggttgcgggcgcggag
agctttacctccacgccgacgaccggcgagggccagagtttttccaaaggcacgcccgcg
ctggtcgaccaggccgtgcaggccgcagaggacgcgttctggacctatggctacacgacg
cgcgaagagcgcgcggcgtttctcgaaaccatcgccgccgagatcgaagcccgcgccgat
ctgatcacgcccactgccatggcggaaagcggcttgcccgaagcgcgtcttgtgggcgag
cgcgaacgcaccactggccagctcaaactttttgccgatcacattcgcaaaggcgactat
ctggaccgccgccatgacgaggccctgccgaatcgcgcgcctctgccgcgtcccgatctg
cgtctgatgcagcgccccatcgggccggtcgcggtgttcggcgcgtcgaactttccgctc
gctttctcggtcgcgggcggggacacggcctctgccttggcggcgggttgtccggtcgtt
gtgaagggccacgaagcccacccggccacctccgagatcgtcgccgacgccttcaaagcc
gcaattgaaacatgcggcttgcctgcgggcgtcttctcaatggtgcatggcggcgcgcac
aaggtcggcgcggctttggtccagcatcatctgatcaatgccgtgggcttcaccggctct
ctcgctggtggccgcgcgctgttcgatctctgcgccaagcgggtcaacccgatcccgttc
tttggcgagctgggctcggtcaacccgatgttcctcttgccggaggcgctctcggcacgc
ggtgaggagcttggcaaaggctgggccgggtcgctggcgatgggggcggggcagttctgc
accaatccggggatcgtcgtggttatcgaaggcgccgaagaagaggcctttaccaaagcg
gcgctcgcggcgctcaccgccaccgggtcacaggtcatgctcaccgagggcatcgccagc
gcctatgtcaaaggcggcgccaagatcaaaacccagcccggcgtgcaggagcttttgacc
cagatgtgcgaccgccgcgaggcgaaacccttcctgttcaaagtgaaggccgaagattgg
ctgacgaatgagaccctgtcggaagaggtctttggtccgctcggtctgatcgtcaccgtg
aaggacgcggcgcaaatgatcgaggtggcgaaatcctttgagggccagctgaccgcgacc
ctgcatatggatgaggccgatatggcgcttgcgggtcagctcatgcccattctcgaacgc
aaggcgggccgcgtcatggcaaatgggttcccgaccggcgtcgaggtgtgcgacagcatg
gtgcacggcgggccttacccggcctcgaccaatttcggggcgacctccgtggggacgatg
gcgattcgtcgcttcctgcgtccggtctgctatcagaacatcccgtctgccgttctgccg
ctggacctcgtgtaa

DBGET integrated database retrieval system