KEGG   Celeribacter ethanolicus: CEW89_08315Help
Entry
CEW89_08315       CDS       T05094                                 

Definition
(GenBank) cobyric acid synthase CobQ
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
ceh  Celeribacter ethanolicus
Pathway
ceh00860  Porphyrin and chlorophyll metabolism
ceh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ceh00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CEW89_08315
Enzymes [BR:ceh01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     CEW89_08315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 CbiA AAA_26
Motif
Other DBs
NCBI-ProteinID: ATG47577
UniProt: A0A291GBP6
Position
1697213..1698664
Genome map
AA seq 483 aa AA seqDB search
MAKAIMIQGAGSNVGKSMLVAGIARAFTRRGLKVAPFKPQNMSNNAAVTADGGEIGRAQA
LQARACGLRPHTDMNPVLLKPETDQGAQVIVQGQRVGTLRARDYGKEKPNLMPKVLESFH
RLASGVDLMVIEGAGSPAEINLRRGDIANMGFAEAAGVPVVLVGDIDRGGVIAQLVGTQA
VLPPEDRDRIKAFAVNKFRGDVSLFAEGSKEIARRTGWVDLGTVPWFQDAHRLPAEDVMD
IASRGDGRVKIAVPKLSRIANFDDLDPLAAEPDVTVEIVEPGRALPGDADLVLIPGTKST
IGDLKFFRAQGWDIDLKAHLRRGGHVLGICGGYQMLGQWIDDPDGIEGHPGRHAALGLLE
VGTRMQGDKRLAEVTATDLSSGAEVRAYEIHIGRTDGPDMERAWLTLEGRPEGAQSPDGQ
VRGCYLHGLFSSDSFRAAYLERFGLSGGMTDFDTGVEETLDLLADHLEAHLDLDALYALA
KEP
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atggccaaggcgatcatgatccagggggcgggctcgaatgtcgggaaatccatgcttgtg
gcagggattgcgcgtgccttcacccgacggggtctcaaggtcgcaccgttcaaaccacag
aacatgtcgaacaatgccgcggtgaccgcagacggcggcgagatcgggcgggcgcaggca
cttcaggcgcgggcctgtgggttgcggccacatacggacatgaatccggtcctgctgaaa
cccgaaaccgatcagggcgcgcaggtgattgtccaagggcaacgcgtcggcacgctcagg
gcccgcgattacggcaaggaaaagcccaatctcatgccgaaggtgctcgaaagttttcac
cggctggcctccggtgtcgatctcatggtgatcgagggcgcgggcagcccggcggagatc
aacctgcgccgcggcgacattgccaatatgggctttgccgaggcggcgggcgtgccggtc
gtcttggtcggcgacatcgaccggggtggcgtgatcgcgcaactggtcggcacgcaagcg
gtgttgccgccggaggaccgcgaccggatcaaagcgtttgccgtcaacaaattccgcggc
gatgtgagcctgtttgccgaagggtcgaaagagattgcccggcgcaccggctgggtcgat
ctcggcacggtgccatggtttcaggacgcccatcgcctgcctgccgaggatgtgatggac
atcgcctcacgcggcgacgggcgggtgaaaatcgccgtgccgaaactttcgcggattgcc
aacttcgacgatctcgatccgctggccgccgagccggatgtgacggtggagattgtcgag
ccggggcgcgcgcttccgggcgatgccgatctggtgctgatcccgggcacgaaatcgacc
atcggcgatctgaaattctttcgcgctcagggctgggacatagacctcaaggcgcatctg
cgacgcggcggccatgtcttggggatttgcggcggctatcagatgcttgggcaatggatc
gacgaccccgacggcatcgaggggcaccccggtcggcacgcggcgctggggcttctggag
gtcggcacccggatgcagggcgacaagcggctggcggaagtgacggcgaccgatctgtct
tccggtgccgaggtgcgggcctatgagatccatatcgggcgcaccgacgggccggatatg
gaacgcgcctggctcacgctcgaagggcggccagagggggcgcaaagcccagacgggcag
gtgcgcggctgttacctgcacgggctgttcagctcggattcttttcgtgccgcgtatctc
gaacggttcggcctctcgggcggcatgacggatttcgacaccggggttgaagagacgctc
gaccttctggcagatcatctcgaggcccatctggacctggatgcgctttatgctctggcg
aaagagccgtga

DBGET integrated database retrieval system