KEGG   Celeribacter ethanolicus: CEW89_16375Help
Entry
CEW89_16375       CDS       T05094                                 

Gene name
phnG
Definition
(GenBank) phosphonate C-P lyase system protein PhnG
  KO
K06166  alpha-D-ribose 1-methylphosphonate 5-triphosphate synthase subunit PhnG [EC:2.7.8.37]
Organism
ceh  Celeribacter ethanolicus
Pathway
ceh00440  Phosphonate and phosphinate metabolism
ceh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ceh00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    CEW89_16375 (phnG)
Enzymes [BR:ceh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.37  alpha-D-ribose 1-methylphosphonate 5-triphosphate synthase
     CEW89_16375 (phnG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PhnG dCMP_cyt_deam_2
Motif
Other DBs
NCBI-ProteinID: ATG49007
UniProt: A0A291GFP5
Position
3328524..3328991
Genome map
AA seq 155 aa AA seqDB search
MGKPETALSPDQKARKAWMGLLAKSDAALLAERMVEMADLPGFEWLRRPEVGGVMVRGRM
GGTGAPFNLGEMTVTRCSLRLATGEVGHGYAQGRDKRQAEQAALVDALMQGARAEAVREA
VLAPLEAAQVAARSARAAKAAATKVDFFTMVRGED
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaacccgaaactgcactctccccggaccagaaggcgcgcaaggcgtggatgggg
cttttggccaaatccgacgccgcgcttttggctgaacggatggtcgagatggccgatctt
cccggttttgagtggctgcggcgtcccgaagtgggcggtgtcatggtgcgcgggcgtatg
ggcggcacgggcgcgccgttcaatctgggcgaaatgactgtgacgcgatgctctctgcgg
ctggcaacgggcgaagtcggccatggctatgcgcaagggcgtgacaagcggcaggcggag
caggcggcgctggtcgatgcgctgatgcaaggggcgcgggccgaagcggtgcgagaggcc
gttctggcaccgttggaagcggctcaggtcgcggcccgtagcgcacgcgccgcgaaagcc
gctgcgacgaaagtggatttctttacgatggtccggggagaggactga

DBGET integrated database retrieval system