KEGG   Corynebacterium epidermidicanis: CEPID_01695Help
Entry
CEPID_01695       CDS       T03955                                 

Gene name
ackA
Definition
(GenBank) acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
cei  Corynebacterium epidermidicanis
Pathway
cei00430  Taurine and hypotaurine metabolism
cei00620  Pyruvate metabolism
cei00640  Propanoate metabolism
cei00680  Methane metabolism
cei01100  Metabolic pathways
cei01120  Microbial metabolism in diverse environments
cei01200  Carbon metabolism
Module
cei_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:cei00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CEPID_01695 (ackA)
   00640 Propanoate metabolism
    CEPID_01695 (ackA)
  09102 Energy metabolism
   00680 Methane metabolism
    CEPID_01695 (ackA)
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    CEPID_01695 (ackA)
Enzymes [BR:cei01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     CEPID_01695 (ackA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase
Motif
Other DBs
NCBI-ProteinID: AKK02224
UniProt: A0A0G3GM55
Position
347643..348842
Genome map
AA seq 399 aa AA seqDB search
MALALVLNSGSSSLKFQLIDPSADATQPPLASGLVEQIGEPSGAVTLKTGGEKYTVSAPI
PDHAVGLSMVFDLMTEHGIGPSQVEITAVGHRVVHGGLLFSQPVVITDEILNMVRDLIPL
APLHNPANIVGIEGAMEILPDVPHVAVFDTGFFHSLPPAAALYAINAEVAAAHGVRRYGF
HGTSHEYVSQQVPALIGRDPEHTRQIVCHLGNGASISAVHNGKAIDTSMGMTPLAGIVMG
TRSGDIDPGIVFHLHRSAGMSIDEIDTLLNKKSGVKGISGVNDFRELRAMIEQDNQDAWL
AYNIYIHNLRKYIGSYMIALGRVDAITFTAGVGENDVDVRASALQDLEVFGIEIDPERNA
LPNTGPRIISTDSSKVKVLVVPTNEELAIARYAVQLAGE
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atggcactggcacttgtccttaattccgggtcttcctcgctgaaattccagctcatcgac
ccatcggctgacgctacgcagccacctttggcttccggtctagtggagcagatcggtgaa
ccatccggcgccgtcaccttgaaaactggcggagaaaagtacacggtctccgcgccgatc
ccagatcacgctgtgggcctttccatggtgtttgacctgatgacagagcatgggatcggg
ccttcgcaggtagaaatcactgctgtggggcaccgtgtagtccacggtggtctgttgttc
tcgcagcccgtcgtgattaccgatgaaatcttgaacatggtgcgcgatctcattccgttg
gcgccattgcacaacccggccaacatcgtcggcattgagggcgcgatggaaatcctgccg
gacgtcccacacgttgccgttttcgataccgggttcttccattccttgccgccagcagca
gcgctgtacgccatcaacgctgaagttgctgctgcgcatggcgtgcgacgctacggattc
catggcaccagccacgagtacgtttcgcaacaggttccagcgctgatcggccgcgatccg
gaacacacccgtcagattgtctgccacctgggcaatggcgcgtcgatctccgcagtgcac
aatggcaaggcgatcgatacttccatgggtatgaccccgctcgcgggcatcgtcatgggc
acccgctccggcgatattgatcccggcatcgttttccacctacaccgttccgccggaatg
tcgatcgatgagattgacaccctgctcaacaaaaagtcgggtgtgaagggtatttccgga
gttaatgacttccgcgaattgcgcgcgatgatcgagcaggacaatcaagatgcttggttg
gcttacaacatctacatccacaacctgcgcaaatacatcgggtcgtacatgatcgcgctg
ggtcgtgtcgacgcgatcactttcaccgcaggcgtcggtgaaaacgatgtcgatgtgcgt
gcctcggcgctgcaggacctggaagttttcggcatcgagatcgacccggaacgcaacgcg
ctgcctaatactgggccgcgcatcatctcgacagactcctctaaggtcaaggtgctggtc
gtgcctaccaacgaggagctagctatcgcgcgctacgccgtgcaactcgcaggagagtag

DBGET integrated database retrieval system