KEGG   Corynebacterium epidermidicanis: CEPID_02930Help
Entry
CEPID_02930       CDS       T03955                                 

Gene name
pit
Definition
(GenBank) phosphate/sulfate permease
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
cei  Corynebacterium epidermidicanis
Brite
KEGG Orthology (KO) [BR:cei00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    CEPID_02930 (pit)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AKK02466
UniProt: A0A0G3GML0
Position
complement(594244..595461)
Genome map
AA seq 405 aa AA seqDB search
MTATLIILAIVVVTALAFDFTNGFHDTANAMATSIATGALKPFNAVAISALLNLIGAFLS
VNVAATVAKGIVNLNSYDVSNIADGEALLMVVFTGLIGGIFWNLFTWLLGMPSSSSHALF
GGLIGAAFAAMGTSGVAWSSIAGKIIIPAIVSPFIAALVSACGTFLVYWVTNTIPNKIKN
EHFRHGQIVTACLVSLAHGAGDAQKTMGVIFLALVAAGEAQSTQHIPTWVIVACAVAIAA
GTLSGGWRVIRTLGKGLVEIESPQGMAAESSSAAIILTSAVGGMALSTTHVSTGSILGTG
LGKKGANVRWGVAMRMVAAWLITLPCAAAVGFASWWLAHGVTAMSNITAGAIVDLILLIA
MVAVILVRARMNPVDASNVNDDWDADAESVDSSMKPVIKPLAQEA
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
gtgactgcaaccctcatcatcctggctatcgtcgtcgttactgctttggcgtttgacttc
accaacggctttcacgacaccgctaacgcgatggctacgtccatcgccacgggcgcgctg
aagcccttcaacgcagtggcgatttcggcgctcctcaacctgattggtgcctttttgtcc
gtgaacgtggccgcgactgtggccaaaggcatcgtgaatctcaactcctacgatgtcagc
aacattgccgacggcgaagcactactcatggtagtgttcactggcttgatcggtggtatt
ttttggaatctcttcacctggctcttgggcatgccttcttcgtcctcgcacgcgttgttc
ggcggactcattggtgcagcgttcgcagccatgggcactagtggcgtggcctggtcttcg
atcgctgggaagatcattatcccggcgattgtttcgcctttcattgcggcgctggtgtct
gcttgcggaaccttcttggtctattgggttaccaacacgatccccaacaagatcaagaac
gagcatttccgccacggccagatcgtcaccgcgtgcctcgtctccttggcccacggagct
ggagatgcgcaaaagaccatgggcgtcatcttcctggcattggttgcggccggcgaggca
caaagcacgcagcacatcccgacctgggtgatcgtggcatgtgcggtagccatcgccgcc
ggcaccttgtcgggcggctggcgcgtgatccgcaccttgggcaagggcctggtggaaatt
gagtctccgcagggcatggctgccgagtcctcttccgccgcgatcatcctcacctctgct
gtgggtggcatggccttatcgacgacgcacgtctccaccggctcgatccttggcacaggc
ttgggcaagaagggcgctaacgttcgctggggtgtcgcaatgcgcatggtggccgcttgg
ttgatcaccctgccgtgtgctgccgccgtcggctttgcttcctggtggctggcgcacggg
gtgacagcgatgtcgaacatcaccgccggcgcaatcgtcgaccttatcctactgattgcc
atggttgccgtgattttggtgcgtgctcgcatgaaccctgtggacgcctccaacgtcaac
gacgattgggatgccgacgccgaatccgtagattcttcgatgaaaccagtaatcaagcca
ctcgctcaggaggcttaa

DBGET integrated database retrieval system