KEGG   Corynebacterium epidermidicanis: CEPID_11045Help
Entry
CEPID_11045       CDS       T03955                                 

Gene name
hemL
Definition
(GenBank) glutamate-1-semialdehyde-2,1-aminomutase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
cei  Corynebacterium epidermidicanis
Pathway
cei00860  Porphyrin and chlorophyll metabolism
cei01100  Metabolic pathways
cei01110  Biosynthesis of secondary metabolites
cei01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cei00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CEPID_11045 (hemL)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cei01007]
    CEPID_11045 (hemL)
Enzymes [BR:cei01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     CEPID_11045 (hemL)
Amino acid related enzymes [BR:cei01007]
 Aminotransferase (transaminase)
  Class III
   CEPID_11045 (hemL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AKK04038
UniProt: A0A0G3GWV8
Position
complement(2330125..2331441)
Genome map
AA seq 438 aa AA seqDB search
MSQLTSSNTANSAAWFERAQRRTPGGVNSPVRAFGSVGGQARFIAFANGSKLVDVDGNEY
VDLFCSWGPMLMGNAHPEILKAVQDATTRGLSYGAPTTAEVELAELVVERTSVEEVRFVN
SGTEATMSAVRLARGFTGRPKIIKFDGCYHGHVDALLASAGSGVATFGLPDSPGVTGAAA
GDTIVVEYNNIEAVKQAFAKHPGEIAAIITEAAAGNMGTVAPKPGFNQALKDVAHENGAL
LIMDEVMTGFRTSYSGWYGVDGVAGDLTTFGKVISGGLPAAAFGGRKDIMEYLAPNGPVY
QAGTLSGNPVAMAAGMASLSLANEQVYETVNANADRLAQLVTEALAKEGVAHHIQRASNM
LSVRFAEGEGHNFKDMQNADTFRFPPFFHALLDRGVYISPSVFETWFVSSALTEQDFDKI
AAAVKPAAQAAAAAKKDA
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcagctcacctcatcgaataccgccaattccgcagcttggttcgagcgagcgcag
cgccgcacaccgggcggcgtgaactcgccagttcgcgcgttcggcagtgtcggtggccag
gcccgcttcattgctttcgccaacggcagcaagcttgtcgacgtcgacggcaacgaatac
gtcgatctgttctgttcttggggcccgatgctcatgggcaatgctcacccggagattctg
aaggccgtccaagacgccaccacccggggtctttcctatggcgcgccgaccaccgcagaa
gtggaactagccgaacttgttgtggagcgtaccagcgtcgaagaggtccgcttcgtcaac
tccggcaccgaggccacgatgtccgcagtccgcctggctcgtggtttcactggtcgcccg
aagatcatcaagtttgacggttgctaccacggccacgttgatgccctgctcgcgtctgcc
ggctccggtgtcgccacctttggcctgccagattccccaggcgtgactggtgctgcggct
ggcgacaccatcgtcgtggaatacaacaatattgaggcagtcaaacaagccttcgccaag
cacccaggcgagatcgccgccattatcaccgaggccgccgccggaaacatgggtaccgtt
gcgccaaaacctggcttcaaccaggctctgaaggacgtcgcacatgaaaacggtgcgctg
ctcattatggatgaggttatgaccggcttccgcacttcctactccggttggtacggcgtc
gacggcgtggcaggcgacctcaccaccttcggcaaggtcatctccggtggcctcccggcg
gccgcgttcggtggacgcaaagacattatggagtacttggcaccgaacggcccggtgtac
caggccggcacactttctggtaacccggtggcgatggcggccggtatggcgtcgctaagc
ctggcaaatgagcaggtctatgagacggtgaacgcgaatgccgatcgcctggcccagctg
gtcaccgaggcgctggccaaggaaggcgtggcgcaccacatccagcgcgcgtcgaacatg
ctgtccgtacgctttgccgagggcgaggggcacaactttaaagacatgcagaacgcggat
acgttccgcttcccgccgttcttccacgcgctgctggatcggggcgtgtatatttccccg
agtgtgttcgagacgtggtttgtctctagcgcgctgacggagcaggactttgacaagatt
gcagccgcagtgaaaccagcagctcaggcggctgccgctgcgaagaaggacgcgtaa

DBGET integrated database retrieval system