KEGG   Caenorhabditis elegans (nematode): ATP6Help
Entry
ATP6              CDS       T00019                                 

Definition
(RefSeq) ATP synthase F0 subunit 6
  KO
K02126  F-type H+-transporting ATPase subunit a
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel00190  Oxidative phosphorylation
cel01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cel00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    ATP6
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:cel03029]
    ATP6
Mitochondrial biogenesis [BR:cel03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA-encoded proteins
   F-type ATPase
    ATP6
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-synt_A
Motif
Other DBs
NCBI-GeneID: 2565704
NCBI-ProteinID: NP_006956
UniProt: P24888 G5EFS7
Position
MT:2634..3233
Genome map
AA seq 199 aa AA seqDB search
MNQVYFLDIFMFVFVLQFLFYFKESMLNTLVKKFLNSLVGVFSYTNTLPLSSVISIFTFI
VLLTCCFGGYFTYSFCPCGMVEFTFVYAAVAWLSTLLTFISSEKFSVYMSKPGDTYLKTL
SMLLIEIVSEFSRPLALTVRLTVNITVGHLVSMMLYQGLELSMGDQYIWLSILAIMMECF
VFFIQSYIFSRLIFLYLNE
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
attaatcaagtttattttttagacatttttatatttgtttttgttttacaatttttgttt
tattttaaagaaagtatattaaatactttagtgaaaaaatttcttaataggttagtagga
gtatttagatatacaaatactttaccattaaggtcagtaatttctatttttacttttatt
gttcttttaacttgttgttttggaggttattttacttactctttttgtccttgtggaatg
gttgaatttacttttgtttatgctgctgtagcgtgattaagtactttgttaacttttatt
tcaagagaaaaattttcagtttatataagaaaaccaggagacacatatttgaaaactctt
agaatgctattaattgaaatcgttagagaattttctcgtccacttgctttaacagtgcgt
ttaacagttaatattactgttggtcatttagttagaataatgctttatcaaggattagaa
ttaagaataggtgatcagtatatttgattatcaattttagccattataatagaatgtttt
gttttcttcattcaaagttatattttctctcgtttaatttttttatatcttaatgagtaa

DBGET integrated database retrieval system