KEGG   Caenorhabditis elegans (nematode): CELE_B0024.12
Entry
CELE_B0024.12     CDS       T00019                                 

Symbol
gna-1
Name
(RefSeq) Glucosamine 6-phosphate N-acetyltransferase
  KO
K00621  glucosamine-phosphate N-acetyltransferase [EC:2.3.1.4]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel00520  Amino sugar and nucleotide sugar metabolism
cel01100  Metabolic pathways
cel01250  Biosynthesis of nucleotide sugars
Module
cel_M00892  UDP-N-acetyl-D-glucosamine biosynthesis, eukaryotes, glucose => UDP-GlcNAc
Brite
KEGG Orthology (KO) [BR:cel00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CELE_B0024.12 (gna-1)
Enzymes [BR:cel01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.4  glucosamine-phosphate N-acetyltransferase
     CELE_B0024.12 (gna-1)
SSDB
Motif
Pfam: Acetyltransf_1 Acetyltransf_7 Acetyltransf_10
Other DBs
NCBI-GeneID: 179437
NCBI-ProteinID: NP_505654
WormBase: WBGene00001646
Ensembl: WBGene00001646
UniProt: Q17427
Structure
Position
V:complement(10319654..10320151)
AA seq 165 aa
MSHIFDASVLAPHIPSNLPDNFKVRPLAKDDFSKGYVDLLSQLTSVGNLDQEAFEKRFEA
MRTSVPNYHIVVIEDSNSQKVVASASLVVEMKFIHGAGSRGRVEDVVVDTEMRRQKLGAV
LLKTLVSLGKSLGVYKISLECVPELLPFYSQFGFQDDCNFMTQRF
NT seq 498 nt   +upstreamnt  +downstreamnt
atgtctcacatttttgatgcgtctgtgttagctccacacattccttcgaatcttcctgac
aattttaaagttcgtcccttggcaaaagacgatttctcgaaaggatatgttgatcttctg
agtcagttgacttcggtcggaaatcttgatcaggaagcatttgaaaagcgatttgaggcg
atgaggacctcggtccccaattatcatatagtcgtcatcgaagattccaattctcaaaaa
gttgttgcatctgccagtttggttgtcgaaatgaagttcattcacggggcaggaagtcgc
ggaagggttgaagatgttgtcgtggatactgaaatgcgtcgtcaaaaattaggagccgtt
cttttgaagactcttgtttctcttggaaagtctctcggagtttacaaaatttctctcgag
tgtgttcctgaacttctcccattctactcacaattcgggttccaggacgattgcaatttt
atgactcagcgcttctaa

DBGET integrated database retrieval system