KEGG   Caenorhabditis elegans (nematode): CELE_B0280.1
Entry
CELE_B0280.1      CDS       T00019                                 

Gene name
ggtb-1
Definition
(RefSeq) Probable geranylgeranyl transferase type-2 subunit beta
  KO
K05956  geranylgeranyl transferase type-2 subunit beta [EC:2.5.1.60]
Organism
cel  Caenorhabditis elegans (nematode)
Brite
KEGG Orthology (KO) [BR:cel00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:cel01006]
    CELE_B0280.1 (ggtb-1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cel04131]
    CELE_B0280.1 (ggtb-1)
Enzymes [BR:cel01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.60  protein geranylgeranyltransferase type II
     CELE_B0280.1 (ggtb-1)
Prenyltransferases [BR:cel01006]
 Protein prenylation
  Rab geranylgeranyltransferase
   CELE_B0280.1 (ggtb-1)
Membrane trafficking [BR:cel04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    CELE_B0280.1 (ggtb-1)
 Endosome - Lysosome transport
  Rab GTPases and associated proteins
    CELE_B0280.1 (ggtb-1)
SSDB
Motif
Pfam: Prenyltrans SQHop_cyclase_N SQHop_cyclase_C
Other DBs
NCBI-GeneID: 175998
NCBI-ProteinID: NP_498559
WormBase: WBGene00015099
UniProt: P41992
Position
III:join(7133883..7133885,7133933..7134058,7134113..7134187,7134243..7134471,7134524..7134799,7134845..7135008,7136274..7136408)
AA seq 335 aa
MSFAGLLDFARKDVDLPQNSPNELLKDLHANFINQYEKNKNSYHYIMAEHLRVSGIYWCV
NAMDLSKQLERMSTEEIVNYVLGCRNTDGGYGPAPGHDSHLLHTLCAVQTLIIFNSIEKA
DADTISEYVKGLQQEDGSFCGDLSGEVDTRFTLCSLATCHLLGRLSTLNIDSAVRFLMRC
YNTDGGFGTRPGSESHSGQIYCCVGALAIAGRLDEIDRDRTAEWLAFRQCDSGGLNGRPE
KLPDVCYSWWVLASLAILGRLNFIDSDAMKKFIYACQDDETGGFADRPGDCADPFHTVFG
IAALSLFGDDTLESVDPIFCMTKRCLGDKQVEMYY
NT seq 1008 nt   +upstreamnt  +downstreamnt
atgagctttgctggacttttagattttgctcggaaggatgtcgatctgccgcaaaattct
ccaaacgaattactgaaagatctacatgctaactttatcaatcaatacgagaaaaacaaa
aatagctatcattatataatggctgaacatctgagagtgagcggaatttattggtgtgtc
aacgcgatggatttatcaaagcagctcgagagaatgtcgactgaggaaatcgtgaattac
gtacttggctgtcggaacacggacggaggatatggacctgctcctggtcatgatagtcat
cttctacacacactgtgtgctgttcaaactttgattattttcaattcaattgagaaagca
gatgcggatacaatcagcgaatatgtgaaaggcttgcaacaagaagacggaagcttttgt
ggagatttatctggagaagttgatacacgattcactctgtgctctctcgctacttgtcat
ttacttggtcgactgtccacattgaatatcgattcagctgtacgatttctcatgagatgt
tacaatacggatggtggattcggaacacgcccaggatctgaaagtcattccggacagata
tactgttgtgttggagctctggcgattgccggacgacttgatgagattgatagagataga
acagccgaatggcttgctttcaggcaatgtgatagtggaggattaaatggtcggcctgag
aaattacccgatgtatgttattcctggtgggttctcgcttctctcgccattctcggacgc
ctcaatttcattgattctgatgctatgaaaaagttcatatacgcttgtcaagatgatgaa
actggaggatttgcagacaggcccggagattgtgcggatcccttccacacggtctttggc
atagctgcactttctctgtttggagacgacacattggagtcagtggacccaattttctgc
atgaccaagagatgtctcggtgataagcaagtggagatgtattactaa

DBGET integrated database retrieval system