KEGG   Caenorhabditis elegans (nematode): CELE_B0336.10Help
Entry
CELE_B0336.10     CDS       T00019                                 

Gene name
rpl-23
Definition
(RefSeq) 60S ribosomal protein L23
  KO
K02894  large subunit ribosomal protein L23e
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel03010  Ribosome
Module
cel_M00177  Ribosome, eukaryotes
Brite
KEGG Orthology (KO) [BR:cel00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    CELE_B0336.10 (rpl-23)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:cel03011]
    CELE_B0336.10 (rpl-23)
Ribosome [BR:cel03011]
 Ribosomal Proteins
  Eukaryotes
   Large subunit
    CELE_B0336.10 (rpl-23)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L14
Motif
Other DBs
NCBI-GeneID: 175796
NCBI-ProteinID: NP_498231
WormBase: WBGene00004435
Ensembl: WBGene00004435
UniProt: P48158
Position
III:complement(join(5705604..5705800,5705897..5706122))
Genome map
AA seq 140 aa AA seqDB search
MSKRGRGGASGAKFRISLGLPVGAVMNCADNTGAKNLFVISVYGIRGRLNRLPSAGVGDM
FVCSVKKGKPELRKKVLQGVVIRQRKQFRRKDGTFIYFEDNAGVIVNNKGEMKGSAITGP
VAKECADLWPRIAANAGSIA
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaagagaggacgtggaggagcttccggagccaaattccgcatttccctcggtctc
ccagtcggagccgttatgaactgcgccgacaacaccggagccaagaacttgttcgtcatc
tccgtttacggaatccgtggacgtctcaacagactgccaagcgctggagttggagacatg
ttcgtctgctccgtcaagaagggaaagccagagctcagaaagaaggttctccaaggagtc
gtcatcagacagcgcaagcagttccgcagaaaggacggtaccttcatctacttcgaggat
aacgcaggagttatcgtcaacaacaagggagaaatgaagggatccgccatcaccggacca
gttgccaaggagtgcgctgatctctggccaagaatcgctgctaacgctggatccatcgct
taa

DBGET integrated database retrieval system