KEGG   Caenorhabditis elegans (nematode): CELE_B0393.1
Entry
CELE_B0393.1      CDS       T00019                                 

Gene name
rps-0
Definition
(RefSeq) 40S ribosomal protein SA
  KO
K02998  small subunit ribosomal protein SAe
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel03010  Ribosome
Brite
KEGG Orthology (KO) [BR:cel00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    CELE_B0393.1 (rps-0)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:cel03011]
    CELE_B0393.1 (rps-0)
Ribosome [BR:cel03011]
 Ribosomal proteins
  Eukaryotes
   Small subunit
    CELE_B0393.1 (rps-0)
SSDB
Motif
Pfam: Ribosomal_S2 40S_SA_C Ribosomal_S22
Other DBs
NCBI-GeneID: 175628
NCBI-ProteinID: NP_497978
WormBase: WBGene00004469
Ensembl: WBGene00004469
UniProt: P46769
Position
III:complement(join(4753050..4753382,4753430..4753531,4753579..4753841,4753914..4754046))
AA seq 276 aa
MSGGAAHSALTEEDVMKLLATQAHLGSTNLNFQMQQYVYKRRFDGPNIINVKKTWEKLLL
AARAIAAVENPADVVVVSARPYAQRALLKFAAHTGATAIFGRFSPGCLTNQIQKTFKEPR
LLVISDPRIDHQAVTEASYVGVPVISFVNTESPLKLIDIGVPCNNKGERSIGLMWWMLAR
EILILRGKISRQTGFVLEGKEIMPDLYFYRDPTETEKEETGAHADVAEAQEYQQPTDIDF
TTQGGKVDDWAAETATWTAETKTTEEWANAPTQSNW
NT seq 831 nt   +upstreamnt  +downstreamnt
atgtcaggcggtgccgctcattccgccctcactgaggaggatgttatgaagcttcttgct
acccaggcccatttgggatccaccaatcttaacttccaaatgcagcaatacgtctacaag
agacgttttgacggaccaaatatcatcaacgtcaagaagacctgggagaagcttcttctc
gctgcccgcgctatcgccgctgttgagaacccagctgatgtcgtcgttgtttcggctaga
ccatacgcccagcgtgctcttctcaagttcgctgctcataccggagctaccgccatcttc
ggacgtttctctccaggatgtcttaccaaccagatccaaaagaccttcaaggagccaaga
cttctcgtcatctctgacccacgtatcgatcatcaggctgtcactgaggcttcctacgtc
ggagttccagtcatctccttcgtcaacaccgagtctccactcaagttgatcgacatcgga
gttccatgcaacaacaagggagaacgctcaatcggacttatgtggtggatgctcgctcgc
gagatcctcattctccgtggaaagatctcccgtcaaaccggattcgtcctcgaaggaaag
gaaatcatgccagatctttacttctaccgtgacccaactgagaccgagaaggaggagact
ggagctcacgctgatgttgctgaggctcaagaataccaacaaccaactgacatcgacttc
accacccaaggaggaaaggttgacgattgggccgctgagaccgctacctggactgccgag
accaagaccaccgaagagtgggccaacgctccaacccagtctaactggtaa

DBGET integrated database retrieval system