KEGG   Caenorhabditis elegans (nematode): CELE_B0564.4
Entry
CELE_B0564.4      CDS       T00019                                 

Gene name
best-2
Definition
(RefSeq) Bestrophin homolog 2
  KO
K22204  bestrophin, other
Organism
cel  Caenorhabditis elegans (nematode)
Brite
KEGG Orthology (KO) [BR:cel00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cel02000]
    CELE_B0564.4 (best-2)
Transporters [BR:cel02000]
 Other transporters
  Pores ion channels [TC:1]
   CELE_B0564.4 (best-2)
SSDB
Motif
Pfam: Bestrophin
Other DBs
NCBI-GeneID: 182044
NCBI-ProteinID: NP_502524
WormBase: WBGene00007204
Ensembl: WBGene00007204
UniProt: Q17529
Position
IV:complement(join(13111520..13111825,13112030..13112675,13112722..13112856,13112904..13113082))
AA seq 421 aa
MTINYHKEIKTSHTWKFFVLLFRWKGSIWKAIYMETIIFLICYGIISVVYRTAMSEPSQR
TFESVIRYCDKRLSFIPLEFVLGFFVTIVVDRWTKLWRTVGFIDDVCLLANLYVRGTSEK
AIIYRRNIARYCALTQLLVFRDVSMRTRRRFPTMETVVAAGFMSKDELDLYNSYTTKNNS
RLGKKYWIPANWALCMTYKARKDGYIESDYFKAQMEGEIRTWRTNIEWVCNYDWVPLPLM
YPQLVCLAVNLYFLVSIIARQLVIEKHKMVDEVDVYFPVMTFLQFIFYMGWLKVIEVMLN
PFGEDDDDFETNALIDRNITMGLKMVDNTMKTPELLKDQFFDEVLVSLLYSEESSQISNY
HYHGSTSEVHLEQKCSSVRMIPHSQSEYTLKHMRKQTLSRSVLPDVNENERWKIPTSLEK
F
NT seq 1266 nt   +upstreamnt  +downstreamnt
atgacaataaactatcacaaagagatcaaaacttcgcacacgtggaaatttttcgtatta
ctattcagatggaaaggttcaatctggaaggccatttacatggagaccatcatatttctg
atttgttatggaataatatcagttgtctatagaactgcaatgagtgaacctagtcaaaga
acattcgaatcagttatacggtactgcgacaaacgcttgtcattcattccattggaattc
gtccttgggttctttgtgacaatagtagtcgaccgctggacaaagctttggagaactgtt
ggatttattgatgacgtttgccttcttgcaaacctctatgttcgtggaacatctgagaaa
gcaataatttatcgccggaatattgcaagatattgtgctttaacccaacttttggtattt
cgagatgttagcatgagaactcgtcgaagatttccaacgatggagacagttgtagcggct
ggatttatgagtaaagatgagctcgacttgtataatagttacacaacaaaaaataatagt
agactcgggaaaaagtactggattccggcgaactgggcgctttgcatgacttacaaagca
cgtaaagatggatacatcgagagtgactatttcaaagctcaaatggaaggagaaatcaga
acatggagaacaaatatcgaatgggtgtgtaattatgattgggtaccattacctctgatg
tatccacaacttgtatgcctcgctgtcaatttgtactttttggtgtcaattattgccagg
caacttgtcattgagaagcataagatggtagacgaagttgatgtctatttccctgttatg
acttttctccagttcattttctatatgggatggctcaaagtaattgaagttatgctgaat
ccatttggagaagatgatgacgactttgagaccaatgcgttaattgatagaaatataacg
atgggactcaagatggtggataacacaatgaaaaccccggaacttctaaaggatcagttt
ttcgacgaagtcctggtctccttgctatattctgaagaatcatctcaaatttcaaattat
cattatcacggttcaacgtccgaagtccatctggaacaaaaatgtagctctgttcgaatg
atacctcactcacaatcagaatatactttgaagcatatgagaaagcaaacccttagcaga
agtgtcttacctgatgtgaatgaaaatgaaaggtggaagatcccaacgagtttggagaaa
ttttag

DBGET integrated database retrieval system