KEGG   Caenorhabditis elegans (nematode): CELE_C01B12.3
Entry
CELE_C01B12.3     CDS       T00019                                 

Gene name
best-3
Definition
(RefSeq) Bestrophin homolog
  KO
K22204  bestrophin, other
Organism
cel  Caenorhabditis elegans (nematode)
Brite
KEGG Orthology (KO) [BR:cel00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cel02000]
    CELE_C01B12.3 (best-3)
Transporters [BR:cel02000]
 Other transporters
  Pores ion channels [TC:1]
   CELE_C01B12.3 (best-3)
SSDB
Motif
Pfam: Bestrophin
Other DBs
NCBI-GeneID: 173379
NCBI-ProteinID: NP_493632
WormBase: WBGene00015286
Ensembl: WBGene00015286
UniProt: O17206
Position
II:join(12986..13060,13104..13207,13251..13385,13433..13532,13579..13800,13849..14169,14577..14725,14770..15063,15114..15237,15498..15690,15737..15858)
AA seq 612 aa
MTVTYSLDVASSSFFCLYKLLFRWKGSIWKSVWAELVVWLCLYAVLSVIYRCLLTMKQRA
TFEDLCIFFDTYSNFIPITFMLGFYVSAVFTRWWQIFDNIGWIDTPCLWITQYIKGETER
AKCVRRNCIRYSILTQAMVYRDVAASVRKRFPTFNHLVTAGLMTEKEMAEFESIPSPHAK
YWQPMHWLFSMITLARDEGMISSDIIYVDLMEKMRQFRVNILSLTLFDWVPVPLVYTQVV
HLAVRSYFLIALFGRQYLHPESNRLNDFKQTIDLYVPIMSLLQFIFFIGWMKVAEVLLNP
LGEDDDDFECNWILDRNLQVGLMVVDTAYNRYPTLEKDQFWEDAIAEPLYTAESAMRPLN
PQVGSCADMPTEEEPFMVRPRRRTLSRMSHWDGDMEDTDVVPVVGLKHTRDNSNYASGES
LAFSNSFANGGRKLSEMFRRMRAGSRIGDRYRKRNSSAQDFENGMAKKNSIDENADIHSN
RLDQASGTPKSGRLWSSMPQTQLEEMLKNKNFNSPVKYNTDGMKDRELQNPTPITDHIDL
PLHVASSQSWFNESLPVIKEEEEAKRKSNTDTESPKSSKHSSMSIRRSELRRSSSSGSDL
GKSGKRERKKSE
NT seq 1839 nt   +upstreamnt  +downstreamnt
atgactgtaacttattcactcgatgttgcttcttcttcttttttctgcttatacaaacta
ctatttcgatggaaggggtcaatctggaaatcggtgtgggctgagcttgtagtttggctt
tgtctttatgcagtgcttagtgttatttatcgatgccttttaacaatgaagcaaagagca
acgttcgaagatctttgtatattttttgatacttattccaatttcattccaattacattc
atgcttggattttatgtctctgctgttttcacacgatggtggcagattttcgacaacata
gggtggattgacacgccttgtctttggataactcaatatatcaaaggggaaacagagcga
gcaaagtgtgtgagaagaaattgtataagatactcaattcttacacaggctatggtgtac
cgtgacgttgcagcaagcgttcgcaaacgtttccccactttcaatcatttagttactgct
ggcttgatgacagaaaaagaaatggccgagttcgagtctatccctagtccacacgcaaaa
tattggcagccaatgcattggttgttttcgatgatcactttagcgcgagacgaaggaatg
atttcaagtgatatcatatatgtagacttgatggagaaaatgcgccaatttcgtgtcaac
attctttcattaacattatttgattgggttcctgtccctcttgtttatacacaagttgtc
catcttgcagtacgatcgtatttcctgatagcgttgtttggtagacagtatctccatccg
gagagcaaccgtttaaatgactttaagcaaactattgatttatatgtaccaattatgtca
cttctccaatttatatttttcattgggtggatgaaagttgccgaagtgcttctcaatcct
ttgggagaggatgatgacgattttgaatgcaattggatacttgacagaaatttacaggtg
ggattgatggttgttgatactgcatataaccgttatccaactcttgaaaaagatcagttc
tgggaggacgcaattgcggagcctctttacactgcagagagtgcgatgagacctctgaat
ccacaagtcggatcttgtgcggatatgccaaccgaagaagagcctttcatggttcgtcca
cgaagacggacgctgtccagaatgtcacactgggatggcgacatggaagatactgatgtt
gttccggttgtgggtctgaaacacacgcgtgataatagtaattatgcttctggcgaatct
ctagcattttcgaatagctttgccaatggtggtaggaaactgagtgagatgtttcgaaga
atgagagctgggagcagaattggtgataggtataggaaacgcaactcgtcagcacaagac
tttgaaaatggaatggcaaaaaaaaacagtattgatgaaaatgcagatattcacagtaat
aggctcgatcaagcatccggtacaccaaaatcaggaaggctttggagttcgatgcctcaa
acacaattggaagaaatgcttaagaataaaaactttaactctcctgtcaaatacaacact
gatgggatgaaagaccgagagcttcaaaatccaacaccaatcactgatcacattgatttg
cctttgcatgtggcgagtagtcaatcatggtttaacgaaagtttaccagtaatcaaagag
gaggaagaagctaaaagaaaatccaacacggatacagagtctccaaagtctagtaagcat
tcaagtatgtcaatcagaagatcggaattgagaagatcatcatcttcaggtagtgatcta
ggcaagtctggaaagcgggagagaaagaagagcgagtga

DBGET integrated database retrieval system