KEGG   Caenorhabditis elegans (nematode): CELE_C01F1.3
Entry
CELE_C01F1.3      CDS       T00019                                 

Symbol
C01F1.3
Name
(RefSeq) NAD(P)-bd_dom domain-containing protein
  KO
K12450  UDP-glucose 4,6-dehydratase [EC:4.2.1.76]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel00520  Amino sugar and nucleotide sugar metabolism
cel01100  Metabolic pathways
cel01250  Biosynthesis of nucleotide sugars
Brite
KEGG Orthology (KO) [BR:cel00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CELE_C01F1.3 (C01F1.3)
Enzymes [BR:cel01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.76  UDP-glucose 4,6-dehydratase
     CELE_C01F1.3 (C01F1.3)
SSDB
Motif
Pfam: GDP_Man_Dehyd Epimerase RmlD_sub_bind Polysacc_synt_2 3Beta_HSD NAD_binding_4 Semialdhyde_dh DUF2617
Other DBs
NCBI-GeneID: 173762
NCBI-ProteinID: NP_001040727
WormBase: WBGene00015298
Ensembl: WBGene00015298
UniProt: Q17556
Position
II:join(4295102..4295341,4295736..4296620,4297095..4297237,4297391..4297512,4298313..4298392,4298459..4298884)
AA seq 631 aa
MVYTPKNVVITGGCGFIGSNFVNYIHDAWPTCNFVNIDKLILNSDTQNVAESVRNSPRYK
LVLTDIKNEAAILNVFEQNEIDTVIHFAADCTSTRCYNETAEAVQNNVLSFIQFLETVRT
YGKIKRFVHISTDEVYGDSDLSENEQGKVEFSRLVPGNPYAATKIAGEAYVRAYQTQYNL
PIVTARMNNIYGPNQWDVKVVPRFIEIAKVRGEYTIQGSGKQLRSWLFVDDASAGLKAVC
EKGELHEIYNLGTYYEKNVADLAKTIQEEVDLQLGRAHEPPKYKSIPDRPYNDLRYLISI
EKAKNDLGWEPTTSFDDGMRHTVASALKEHKHVKMHVAIYGGKGYVGQELQHVLNDRHIP
YVLATKKVGFDSDEEVERELALLGVTHVICVTGRTHGPGCNTIEYLEGRADKVFINVRDN
MYSATILAHMCRKLGLHYTYIGTGYMFAYDKEHPIGGAEFKEEDEPTFFGSAYSVVKGFT
DRQMNYFNQNGWENLNVRITLPLSLDLEQPRNLLSKIIKYKELFDIPVSLTILPDCMNAM
CNLMEQRSGGTLNLVNPEPISLYEVVKIYKEIVDETVNPTSIGVETERAQHLLATKGNCA
LDTEKLQSLAPVLSAKQSLIKHFSEMTSAAK
NT seq 1896 nt   +upstreamnt  +downstreamnt
atggtctataccccgaaaaacgtggttatcaccggcggatgtggcttcatcggttcgaac
tttgtcaactacattcacgatgcttggccgacgtgtaattttgtgaacatcgacaagctc
attctgaacagtgacactcagaatgtggcagagtcggtgagaaattccccacggtacaag
ttggtactcactgatatcaagaatgaggcggcgattctcaacgtttttgagcagaatgag
atcgataccgtaatccatttcgccgctgactgtacttctactcggtgctacaatgagacc
gctgaagccgttcagaacaatgttctatcgttcatccaattcttggaaactgttagaacc
tacggaaagatcaaacgattcgttcacatcagtacagacgaggtttacggggactctgat
ctctcggagaatgaacaaggaaaagtggaattctctcgacttgttccaggaaatccgtat
gctgccactaaaatcgccggagaggcctacgtccgtgcctaccaaactcagtacaacctt
ccaattgtgactgcccggatgaacaatatctatgggccaaaccagtgggatgtcaaggtg
gttccaagatttattgagattgcaaaggtccgtggggaatacacaattcaaggaagcggc
aagcaacttcgctcttggctttttgtggacgatgctagtgcaggattgaaggcagtttgt
gagaaaggagaactccacgagatttacaatttggggacttattacgagaaaaatgttgct
gatctagcgaaaacgattcaagaagaagttgatctacaactcggaagagcccacgagcca
ccaaaatacaaatcgattcccgatcgtccgtacaatgatcttcgctatttgataagtatc
gagaaggcgaaaaatgatctcggctgggagccaacgacctcgtttgatgatggaatgcgt
cacactgttgcgtcggcacttaaggaacataaacatgtgaagatgcacgtggcaatctat
ggaggaaagggatatgttggtcaggagttgcagcacgtgctcaatgatagacacattcca
tacgtgttggcaacgaaaaaagtcggatttgatagtgatgaagaggttgaaagagaactt
gcccttcttggagtgacccacgtgatctgcgtgactggaagaacccatgggcccggctgc
aatactattgaatacctcgagggtagagctgataaggttttcattaacgtcagggataat
atgtatagcgcaacaattttggcgcacatgtgtcgaaaattggggctgcactatacgtac
attggcactggttacatgtttgcttatgataaggaacacccgattggaggcgctgagttc
aaagaggaagacgagccgacattctttggttccgcttattctgttgtcaaaggattcacc
gacagacaaatgaactatttcaatcaaaatggctgggaaaacctcaatgtacgaataacg
cttccactcagtttggacttggaacaaccacgaaacttgttatcaaaaatcatcaaatac
aaggaattatttgatattccagtgtcactgaccatccttccagattgtatgaatgcaatg
tgcaatttgatggaacaacgaagcggtggaactctgaacttggtcaatccggagccaatt
agtctttacgaagttgtgaagatttataaggagattgtcgacgagactgtcaatcctaca
tcaattggagtggaaactgaacgtgctcaacatcttctggcaaccaagggaaattgcgca
ttggacactgaaaaactgcagtccttggcgccggttttgtcggcgaaacaaagtcttatt
aagcacttcagcgaaatgactagtgctgctaaataa

DBGET integrated database retrieval system