KEGG   Caenorhabditis elegans (nematode): CELE_C01G6.1
Entry
CELE_C01G6.1      CDS       T00019                                 

Gene name
aqp-2
Definition
(RefSeq) AQuaPorin or aquaglyceroporin related
  KO
K09886  aquaglyceroporin related protein, invertebrate
Organism
cel  Caenorhabditis elegans (nematode)
Brite
KEGG Orthology (KO) [BR:cel00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cel02000]
    CELE_C01G6.1 (aqp-2)
Transporters [BR:cel02000]
 Other transporters
  Aquaporins and small neutral solute transporters [TC:1.A.8]
   Aquaglyceroporins or glycerol-uptake facilitators
    CELE_C01G6.1 (aqp-2)
SSDB
Motif
Pfam: MIP
Other DBs
NCBI-GeneID: 174467
NCBI-ProteinID: NP_001369849
WormBase: WBGene00000170
Ensembl: WBGene00000170
Position
II:complement(join(9259360..9259384,9259671..9259829,9260490..9260958,9261220..9261346,9261881..9261973))
AA seq 290 aa
MILDKLRAKFHIRKELLRAVLAEFTGTYLLCLIGLSVVAQKVLPRPEVNEFIGVNVGFGI
AIVFGVAVSAKLSGGHINPAVSFAFLSVGQITIVQFIAYFVAQFFGAFFGAATVYAVYND
AINVFDGGVRTVGGPKDTAGIFASYPAPHLGLVNGFVDQFVATAVFVFLIAHIVDKRNSY
PTWLQPILVGTGFVAIGAAFGYNCGYPVNPARDFAPRLFTSIFYGGAVFTKWFWVPIVGP
FVGAVVGIWLYYFLIGFHTPQDAEEKYVVLTGNQELKPLTAKETVDEEAA
NT seq 873 nt   +upstreamnt  +downstreamnt
atgatcttggacaaacttcgcgccaagttccacattcgtaaagagttgctccgcgctgtg
ctcgctgagttcaccggaacttacttgctctgtctcatcggactttctgttgtcgcacag
aaggtgttgccaagaccagaagtcaacgaattcattggagtcaacgtcggattcggaatc
gccatcgttttcggtgttgctgtctctgccaaactctccggaggacatattaaccctgcc
gtctcctttgccttcctttccgtcggacaaatcaccatcgtccaattcattgcctacttc
gtcgcccaattcttcggagctttcttcggagccgccaccgtctacgccgtctacaatgac
gccatcaatgtgtttgacggaggagttcgtaccgttggaggaccaaaggacaccgccgga
atcttcgcctcttacccagctccacacctcggacttgtcaacggatttgtcgatcaattc
gtcgccaccgccgttttcgtcttcctgatcgctcacatcgtcgacaagcgcaactcttac
ccaacatggcttcagccaatccttgtcggaaccggattcgtcgccatcggagccgccttc
ggatacaactgcggatacccagtcaacccagctcgtgactttgcaccacgtctcttcacc
tccatcttctacggaggagctgtcttcaccaagtggttctgggttccaattgttggacca
ttcgtcggagctgtcgtcggaatctggctttactacttcttgattggattccacactcca
caagacgctgaggagaagtacgtcgtactcaccggaaaccaggagctcaagccactcacc
gccaaggaaactgtcgatgaagaagccgcctaa

DBGET integrated database retrieval system