KEGG   Caenorhabditis elegans (nematode): CELE_C02B10.5
Entry
CELE_C02B10.5     CDS       T00019                                 

Gene name
C02B10.5
Definition
(RefSeq) Uncharacterized protein
Organism
cel  Caenorhabditis elegans (nematode)
SSDB
Motif
Pfam: PGBA_C
Other DBs
NCBI-GeneID: 177280
NCBI-ProteinID: NP_500719
WormBase: WBGene00015330
Ensembl: WBGene00015330
UniProt: O44447
Position
IV:join(5083547..5083729,5084210..5084331,5084387..5084645,5084702..5085183,5085231..5086105,5086256..5086431)
AA seq 698 aa
MPASSTSSPSSKEEDEKHTSADEDVTPTASPSLVKSEVVKEEENDDADRTLTMPSTSQDI
QPESSPAHGRSAPSSQEITSPPTVRRVATPLEAAEQEYYYFTTDMINQAALDIEREKEKF
DSLITWYKLQRDDVPALGTSSVGNSTAPSYVSEKGSTTPMSSQPSSHQSGTSSTNGAHGG
LNGFSCSPFGLENNPRSNDPMQCMSSPVELDEICPTLEDFMSSAASSSTPSTSSAPQMNQ
NQNTHPNSINHHHQPDTSLLMLNNHHSSPLNQLSFNHQMPSTSNSNPPSNASLKRRATEE
FGNDGPMKQAKIEGSENDNNPMRKLEMMANSSNFRGGNTINEVVEASKKDERTLKMEKLD
VIGKSVGEEFAQQAREAQMRQMQQAAAAAGSMPPSYPSPGQYPGPMHYPGMPPMMPPGAP
FSAGASYPPMGGPFPPNPYGMHPGMTPGGYPMSAPGKMPFGSPSFPQSAPSPAAMAAMQQ
GRMPGPPMPPHMMTPQQQQHFMQMQQAQMAHFNAQKAAAAAAAAGMSPAARASPMGASPS
PHHPHPSQFPPNHPANPMYHHHIMMMRAMHAQGGQPGHPGMMPPGMMPPGMMPPGMMPPG
MHPGMAGMPPMHPGMQGMPPMHPGMQGMPGMPHGPPQPPQNPALMVAGNRAGSAEAAAAQ
MGNPHHPMMGANMWQLTPHYPPPLPASSSSGAGTPVSR
NT seq 2097 nt   +upstreamnt  +downstreamnt
atgccagcgagctcaacatcgtcaccgtcttcaaaagaagaagacgaaaagcacacttcc
gcagatgaagacgtcactccgactgcttctccgtcgttagtgaagtctgaagttgtcaag
gaggaggaaaatgatgacgccgatagaacgttgactatgccatccactagtcaggacatt
cagcctgagtcatctcctgcacacggtcgatcagctccgtcaagccaagaaatcacgtct
ccaccaactgtaagacgagtagctacgccgctcgaggcggcggagcaagagtattattat
ttcacaactgatatgataaaccaagctgcgttggacattgagcgagaaaaggaaaagttc
gactcgctaattacctggtataaacttcaacgtgacgatgtgccggcactcggaacaagc
tccgtaggaaattcaacagctccatcctacgtcagtgagaaaggctcaacaacgccaatg
tcttctcagccatcatcacatcaaagtggaacaagcagtacgaatggggcgcacggtggt
ctcaacggtttttcatgcagtccatttggtctcgagaataaccctcgatcaaatgatccg
atgcagtgcatgagttcaccagtcgaattggatgaaatctgtccaacactggaagatttt
atgtcatcagcggcgtcttcatcaactccatcgacatcatctgcaccacaaatgaaccag
aaccagaatacccatccaaattcgataaatcatcatcatcagccggacaccagtttatta
atgttaaataatcatcattcgagtcctttaaatcagctgagtttcaaccatcaaatgcca
tcaacatcgaactcgaacccaccttcaaatgcatctctaaaacgaagagcaactgaagaa
ttcgggaatgatggtccaatgaagcaagcgaaaattgaaggatcagagaacgacaataat
ccaatgagaaagctggagatgatggcgaattcttcgaattttagaggtggaaacactatc
aatgaagtcgtagaagctagcaaaaaagacgaacgtacgctaaaaatggaaaaactagac
gtcatcggaaagtcagtcggagaagagtttgctcaacaagcccgcgaagctcaaatgagg
caaatgcaacaagcagccgctgccgcaggatcaatgccaccatcctacccatcacctgga
cagtatccaggaccaatgcattatccgggaatgccaccaatgatgccacccggagcacca
ttttctgcaggagcctcgtatccaccaatgggcggaccattcccaccgaatccatatgga
atgcatcccggaatgactccaggaggatatcctatgtctgcaccaggaaaaatgccgttc
ggatccccatcattccctcaaagtgctccatcaccagcagcgatggctgcaatgcaacaa
ggtagaatgccaggaccaccaatgccaccccatatgatgacacctcagcaacaacaacat
ttcatgcaaatgcagcaagctcaaatggctcatttcaatgctcaaaaagctgccgctgct
gcagcagccgccggaatgtctcctgcagctcgggcgtcaccaatgggtgcctcaccgtct
ccccatcatcctcatccttcccaattcccaccgaatcatccggccaatccaatgtatcac
caccacataatgatgatgagagcaatgcatgcacaaggtgggcagccaggacatccagga
atgatgccaccagggatgatgccgcccggaatgatgccgcccggaatgatgccacctggc
atgcatccaggtatggccggtatgccaccaatgcatccaggaatgcagggaatgccgccg
atgcatccgggaatgcaaggaatgcccgggatgccacacggacctccgcaacctccgcaa
aatcccgctctcatggttgccggaaatcgagctggctccgcagaagctgcagctgctcaa
atgggcaatccacatcatccgatgatgggcgccaatatgtggcaattgacaccacactat
ccaccacctcttccagcttcttccagttctggagcaggaacgcccgtttcccgatga

DBGET integrated database retrieval system