KEGG   Caenorhabditis elegans (nematode): CELE_C03A7.8Help
Entry
CELE_C03A7.8      CDS       T00019                                 

Gene name
abu-7
Definition
(RefSeq) Activated in Blocked Unfolded protein response
Organism
cel  Caenorhabditis elegans (nematode)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: C_tripleX
Motif
Other DBs
NCBI-GeneID: 182139
NCBI-ProteinID: NP_504384
WormBase: WBGene00000030
Ensembl: WBGene00000030
UniProt: O16502
Position
V:complement(join(5163396..5164487,5164535..5164759))
Genome map
AA seq 438 aa AA seqDB search
MRFTSLAIAFLACALVVSGSVIREKRQCGCAQPQQSQCSCQQVQQTQSCSCQSAPVQQQS
PSCSCAQPQQTQQVQVQSTQCAPACQQSCQQQCQASPSVSQCQPQCQQQCQAQCTPMYNP
PTTTTTTQAPVVQYQQCQPVCQQQCQSTCVQQQQPAAQCQPQCQQQCNVACDSPSTTTQA
PQVIQIQLEIQQAQAQCQPQCQQQCQSSCVQQQQPSTQCEPACNTQCSDICQQTAQATQQ
VYNQNMNQNTNTQMYNPYNTNTNQNANCAPACQPACDNSCTSQQAQPVYQQAQPTYQVQQ
TTAAPMYDPYNNQGSANCAPACQPACDNSCTSQQTQPMYQPYDTTTEAPAQVIQIVLQTS
VAQSSQCAPQCEQSCQQQCVQQQQPAAQCQTACQSSCSNSCQTAQPATTACQQSPQQSSC
SCQANYSPCGNGQCCRRK
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgcgctttacttcacttgccattgccttccttgcatgtgcccttgtggtatctggaagt
gtaatccgtgaaaagagacagtgtggatgtgctcagccacagcagagccaatgctcgtgc
caacaagttcaacagactcagtcatgctcgtgccaatctgctccagttcaacaacaatcc
ccatcctgctcatgcgctcagccacaacaaactcaacaagttcaggttcaatctactcaa
tgcgccccagcttgccaacagagctgccaacagcaatgccaggcttctccatcagtgtcc
cagtgccagccacaatgtcagcaacagtgccaggctcaatgcactccaatgtacaaccca
ccaaccactactaccaccacccaagctccagttgtccaataccaacagtgccaaccagta
tgccaacagcaatgtcaatctacctgtgttcaacaacaacaaccagcagctcaatgtcag
ccacaatgccaacaacaatgcaatgttgcctgtgattccccatccaccaccacccaggcc
ccacaagtgattcaaattcaacttgagatccaacaagctcaagctcaatgccaaccacag
tgccagcaacaatgccagtcctcatgtgtccagcaacaacagccatcgacccaatgtgag
ccagcctgcaacactcaatgttctgatatctgccaacaaactgctcaggctacccaacaa
gtctacaaccagaacatgaaccagaacaccaacacccaaatgtacaacccatacaatacc
aacaccaaccagaacgctaactgcgctccagcttgccaaccagcctgcgacaactcctgc
acatcccaacaggcccagccagtgtaccaacaagcccagccaacttaccaagtccagcaa
accactgccgctccaatgtacgatccatacaacaaccaaggatctgccaactgcgctcca
gcttgccaaccagcttgtgacaactcctgcacatcccagcagactcaaccaatgtaccaa
ccatacgacaccaccactgaagctccagctcaagtcatccagattgttctccagacttct
gttgctcaatcatcccaatgtgctccacaatgcgaacagtcctgccaacagcaatgtgtt
cagcaacaacagccagctgctcagtgccaaactgcctgccaatcatcatgctctaactcc
tgccaaactgctcaaccagcaactactgcctgccaacagagcccacaacagagctcctgc
tcctgccaagctaactactctccatgcggaaatggacaatgctgccgcagaaagtaa

DBGET integrated database retrieval system