KEGG   Caenorhabditis elegans (nematode): CELE_C03B1.12
Entry
CELE_C03B1.12     CDS       T00019                                 

Gene name
lmp-1
Definition
(RefSeq) LAMP family protein lmp-1
  KO
K06528  lysosomal-associated membrane protein 1/2
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel04140  Autophagy - animal
cel04142  Lysosome
cel04145  Phagosome
Brite
KEGG Orthology (KO) [BR:cel00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    CELE_C03B1.12 (lmp-1)
   04142 Lysosome
    CELE_C03B1.12 (lmp-1)
   04140 Autophagy - animal
    CELE_C03B1.12 (lmp-1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cel04131]
    CELE_C03B1.12 (lmp-1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cel04147]
    CELE_C03B1.12 (lmp-1)
   04090 CD molecules [BR:cel04090]
    CELE_C03B1.12 (lmp-1)
Membrane trafficking [BR:cel04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Cargo receptors
    CELE_C03B1.12 (lmp-1)
Exosome [BR:cel04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   CELE_C03B1.12 (lmp-1)
CD molecules [BR:cel04090]
 Proteins
  CELE_C03B1.12 (lmp-1)
SSDB
Motif
Pfam: Syndecan
Other DBs
NCBI-GeneID: 180912
NCBI-ProteinID: NP_509072
WormBase: WBGene00003053
Ensembl: WBGene00003053
UniProt: Q11117
Position
X:complement(join(6376759..6377016,6377092..6377301,6377356..6377573,6377627..6377654))
AA seq 237 aa
MLKSFVILFAFLASASATASHYYVTNNNTGLTCIILDGDFQFNLVFNEKNTTEKFTVTFN
ETVSVEGDCNGVRNNQSVQTLNIKFNPEGQSARYAKEWELDIVFGSSSNVAFEIIDYTLT
TQRTDLVPYFGKFVRDANAAGDVTATQTNAYKCSTAKLGLVGGSTIDIKTSNVIAFAQMN
GTVFPTDQVYEVCYLDARTNEVVPIVVGACLAALVVVVLVGYLIGRARAKRQGYASV
NT seq 714 nt   +upstreamnt  +downstreamnt
atgttgaaatcgtttgtcatcttgtttgccttcctggcctccgcatccgccaccgcttcg
cattactatgtaaccaacaacaacaccggactcacgtgcatcatcctcgacggagacttc
cagttcaatttggtcttcaacgagaagaacaccaccgagaagttcacggtcacattcaac
gagacagtcagtgtcgaaggagattgcaacggagtccgcaacaatcaatcggttcagacg
ttgaatattaagttcaaccctgaaggacaatctgcccgttacgccaaagagtgggagctc
gatatcgtgttcggatcatctagcaacgtcgcctttgagatcattgactacaccctcacc
actcagagaacggatcttgtcccatactttggaaagtttgtcagagacgccaatgctgcc
ggagatgttacagcaactcagaccaacgcttacaagtgctccaccgccaagcttggactc
gtcggaggatctaccattgacatcaagacatccaacgtgattgcatttgcacagatgaac
ggcaccgttttcccaactgaccaagtctacgaggtgtgctatttggatgctcgcaccaac
gaagttgtcccaatcgtcgtcggagcctgcctcgcggctctcgtcgtggttgtgctcgtc
ggataccttatcggacgtgctcgtgcaaagagacaaggatatgccagcgtctaa

DBGET integrated database retrieval system