KEGG   Caenorhabditis elegans (nematode): CELE_C03H5.4
Entry
CELE_C03H5.4      CDS       T00019                                 
Symbol
C03H5.4
Name
(RefSeq) Phospholipase A2
  KO
K01047  secretory phospholipase A2 [EC:3.1.1.4]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel00564  Glycerophospholipid metabolism
cel00565  Ether lipid metabolism
cel00590  Arachidonic acid metabolism
cel00592  alpha-Linolenic acid metabolism
cel01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cel00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    CELE_C03H5.4 (C03H5.4)
   00565 Ether lipid metabolism
    CELE_C03H5.4 (C03H5.4)
   00590 Arachidonic acid metabolism
    CELE_C03H5.4 (C03H5.4)
   00591 Linoleic acid metabolism
    CELE_C03H5.4 (C03H5.4)
   00592 alpha-Linolenic acid metabolism
    CELE_C03H5.4 (C03H5.4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cel03036]
    CELE_C03H5.4 (C03H5.4)
Enzymes [BR:cel01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     CELE_C03H5.4 (C03H5.4)
Chromosome and associated proteins [BR:cel03036]
 Eukaryotic type
  Centrosome formation proteins
   Centriole proteins
    CELE_C03H5.4 (C03H5.4)
SSDB
Motif
Pfam: Phospholip_A2_1 Phospholip_A2_2
Other DBs
NCBI-GeneID: 182181
NCBI-ProteinID: NP_493719
WormBase: WBGene00015406
Ensembl: WBGene00015406
UniProt: O16654
Position
II:<375250..>375835
AA seq 160 aa
MFLFPLVLGFLLPETLNTFVLEIQFMTRCMTHHDAWIYNGYGCYCGIGGSGDILDDIDEC
CANHDKCYEDLDLKKTCWTTPFEYFPIYSWKCQNQTIHCDTLSEASDHPVLAHECSNQLC
ECDRKLVECWAKYPEPTGQLKCPHPRLSRFLLKLQKKMLS
NT seq 483 nt   +upstreamnt  +downstreamnt
atgttcctttttccacttgttttggggtttttgctgccagaaactctgaatacttttgta
ctcgaaatccaatttatgacacgttgtatgacgcaccatgatgcttggatttacaacggc
tacgggtgttattgtggaattggaggtagtggagacattttagatgatattgacgaatgc
tgtgctaaccatgacaaatgctatgaagaccttgatctcaaaaaaacatgctggacaact
ccatttgaatactttccaatttactcctggaaatgtcaaaatcaaactattcactgtgat
acactaagtgaggcatctgatcatccagtcttagctcacgagtgcagtaatcaattatgt
gaatgtgatcgaaaactcgtggagtgttgggcaaagtacccggagccaacaggacagcta
aagtgcccacatcccaggctttcccggtttttgctgaaattgcagaagaagatgttgagc
taa

DBGET integrated database retrieval system