KEGG   Caenorhabditis elegans (nematode): CELE_C04F6.3Help
Entry
CELE_C04F6.3      CDS       T00019                                 

Gene name
cht-1
Definition
(RefSeq) Probable endochitinase
  KO
K01183  chitinase [EC:3.2.1.14]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel00520  Amino sugar and nucleotide sugar metabolism
cel01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cel00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CELE_C04F6.3 (cht-1)
Enzymes [BR:cel01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.14  chitinase
     CELE_C04F6.3 (cht-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_18 CBM_14 Mucin
Motif
Other DBs
NCBI-GeneID: 180628
NCBI-ProteinID: NP_508588
WormBase: WBGene00000503
UniProt: Q11174
Position
X:complement(join(3397799..3398142,3398199..3399511,3399647..3399761,3399935..3400016))
Genome map
AA seq 617 aa AA seqDB search
MLLGKFLLVASFILPIAYTWTGATIRNHPADVVAARNKITSRSVARSEPTNSYIRPCYFT
NWAQYRQGRAKFVPEDYTPGLCTHILFAFGWMNADYTVRAYDPADLPNDWAGEGMYRRVN
KLKVTDTQLKTLLSFGGWSFGTALFQGMAASSASRKVFIDSAITFVRTWGFDGIDIDWEY
PSGATDMANYVALVKELKAACESEAGSTGKDRLLVTAAVAAGPATIDAGYDIPNLAPNFD
FILLMSYDFFGAWASLVGFNSPLYATTELPAEWNGWNVDSSARYWNQKGMPKEKIIVGMP
TYGRGWTLNNASAINPGTSGSPAKITQYVQEAGVGAYFEFCEMLANGATRYWDSQSQVPY
LVQGNQWWSYDDEESFANKMAYVKREGYGGAFVWTLDFDDFNAGCSNSNGQLYPLISVIA
KELGGVIIPKKGGVTTAPTTVATTVTTGRPPMTSAVTTTTAATTTTTRAATTTTASNTNV
CSGKSDGFYPNSNNCGLFVLCLSSKSYSMSCPSGLQYSASLKYCTTSTASGCSVTTTRAP
TTTTKSAPTVTTTTRAPTTTTPAFKCTKDGFFGVPSDCLKFIRCVNGISYNFECPNGLSF
HADTMMCDRPDPSKCAK
NT seq 1854 nt NT seq  +upstreamnt  +downstreamnt
atgctattaggcaaattccttctcgtggcaagtttcatattgccaattgcatacacatgg
acgggtgctacaattagaaaccatccggcggatgttgtcgctgcacgaaacaaaatcact
tcacgatcagtggcgagatccgagccaaccaatagctacatcagaccgtgctacttcacc
aactgggctcaatacagacaaggacgagccaagtttgtgccagaggattacactccagga
ctctgcacgcatattctctttgcattcggatggatgaacgctgactacaccgttcgagca
tatgatccagcagacttgccaaatgattgggctggagaaggaatgtacagaagagttaac
aagctgaaagtcactgacacccaactcaagacccttctctcgttcggaggatggagtttt
ggaactgcacttttccaaggaatggctgccagttctgcgtctagaaaagtttttatcgac
tctgctatcactttcgttcgcacttggggattcgatggtattgatatcgactgggagtac
ccttctggagcaactgacatggctaactacgttgccctcgtgaaggagttgaaggctgct
tgtgagtcggaagccggaagcactggaaaggatcgtcttcttgtaaccgccgctgtcgcc
gcaggaccagccacaatcgatgctgggtatgatattccaaacttggcaccgaactttgac
tttattcttctcatgagttacgatttcttcggagcatgggcttctcttgttggattcaac
tctccactctatgctacgaccgagctcccagctgaatggaatggatggaacgttgattca
tctgctagatactggaaccagaagggtatgccaaaagagaagatcatcgtcggaatgcca
acatatggacgaggatggactttgaacaatgccagtgcaattaatccaggaacaagcgga
tccccagctaagatcactcaatatgttcaagaagccggagttggagcctacttcgagttc
tgcgagatgctcgccaatggagccaccagatattgggatagccagtctcaagttccatat
ctcgtacaaggaaatcaatggtggtcgtacgatgatgaagagtcgtttgccaacaagatg
gcatacgttaagagagaaggttacggaggagcttttgtatggactcttgattttgacgat
ttcaatgctggatgcagcaactctaatggtcagctttacccactcatcagtgtcattgct
aaggagcttggaggagttatcattccaaagaaaggtggcgtcacaactgctccaaccact
gtagcaactacggtcacaactggacgccctccaatgacttcagcagtaaccacaactact
gccgctaccacaactacaacacgtgcagctactacaaccacagcttccaatacaaatgtc
tgttctggaaaatcggatggattttatccaaacagcaacaactgcggacttttcgttctt
tgtctgagctcaaaatcatacagcatgtcgtgcccatcaggacttcaatactctgcttcc
ctgaaatactgtaccacttccactgcttctggatgttctgtgaccactactagagctcca
actacgacaacaaaatctgcgccaactgtcaccacaactacaagagcaccaacaaccact
acaccggctttcaagtgtaccaaggatggattcttcggagttccgagtgattgcctcaag
tttatccgctgtgtgaatggtatttcatacaactttgagtgccccaacggtttgagcttc
cacgctgacacaatgatgtgtgatcgtccagatccatcaaaatgtgcaaaataa

DBGET integrated database retrieval system