KEGG   Caenorhabditis elegans (nematode): CELE_C05D11.4
Entry
CELE_C05D11.4     CDS       T00019                                 

Gene name
let-756
Definition
(RefSeq) Protein let-756
  KO
K04358  fibroblast growth factor
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel04010  MAPK signaling pathway
cel04020  Calcium signaling pathway
Brite
KEGG Orthology (KO) [BR:cel00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    CELE_C05D11.4 (let-756)
   04020 Calcium signaling pathway
    CELE_C05D11.4 (let-756)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cel04052]
    CELE_C05D11.4 (let-756)
   00536 Glycosaminoglycan binding proteins [BR:cel00536]
    CELE_C05D11.4 (let-756)
Cytokines and growth factors [BR:cel04052]
 Growth factors
  Growth factors (RTK binding)
   CELE_C05D11.4 (let-756)
Glycosaminoglycan binding proteins [BR:cel00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   CELE_C05D11.4 (let-756)
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 175909
NCBI-ProteinID: NP_498403
WormBase: WBGene00002881
Ensembl: WBGene00002881
UniProt: Q11184
Position
III:join(6407137..6407226,6407495..6407566,6407616..6407662,6407869..6408265,6408569..6408634,6408679..6408785,6408837..6408965,6409223..6409592)
AA seq 425 aa
MAVPAASSIVSYGGAATSNFLTTPVTPFLAGFYNSNFVTDRINSCAPYRVDRIRKQLQDE
EENGYPPADDRRRGALFCRSGTWLEMLPIENPDDGSTRVKVHGTKEESSKFSIVEFVSVA
MSLVSIRGVETKNFICMDPSGKLYATPSSNYSTECVFLEEMMENYYNLYASCAYGDRFNP
WYIELRRSGKPRRGPNSKKRRKASHFLVVHHDLDRLRSPVPNGNDVTDLVVASLFHQPPS
HPLFRQQTVTKPPNPHRISNLRAKVEMTNQAEKQRLLEEKKRRREKKKRRREDRLRKEEQ
IREARRQELKSLREEELRRRYQQQQQQQASTQTRYNRPQNPANPYPTYRPLPTRSTVQSP
RPAYNPYWQSPVTQAPHHNSHHHHHHHPRVSSSSDPQQRHQSQQHYLAQTVSNPNRQNVN
YQRYP
NT seq 1278 nt   +upstreamnt  +downstreamnt
atggccgttcctgccgcctcatcgatagtttcatacggaggagcagccacttctaacttt
ttgacaacaccagttacaccttttcttgcgggattctataattcaaattttgtaaccgat
cgtataaattcatgtgctccgtatcgagtggaccggatcagaaaacaactacaagatgaa
gaagaaaatgggtatccacctgctgatgaccgtcgccgcggagccctgttttgtcgttcg
ggaacctggttggagatgcttcctatcgaaaatcctgacgatggatcgacacgtgtcaaa
gttcatggaacaaaagaggagagttccaaattcagtatagtggagtttgtgtcagtggca
atgagtcttgtatcgattcgaggagttgaaacaaagaatttcatttgtatggatccatcg
gggaaattatatgcaacaccatcatctaattattcaacagaatgcgtttttctcgaagaa
atgatggaaaattattacaatttatatgcgtcttgtgcttatggtgacaggtttaatccc
tggtatattgaattacgacggagtggaaaaccaaggagaggtcctaattcaaaaaaacgt
cggaaagcgagccattttctagttgttcatcacgatcttgaccggttacgaagtcccgtt
ccaaatggaaatgacgtaaccgatctggtagttgcttcactctttcaccaacctcccagt
catccattattccgacagcagaccgttacaaaaccaccaaatccacatcgtatttcaaat
ttacgagcaaaagtggaaatgacgaaccaagctgagaagcaaagattattagaagaaaag
aaaagacgaagagaaaagaagaaacgaaggagagaagatcgattaagaaaagaggaacaa
attagagaagcccgtcgccaagagctcaaaagtcttcgtgaagaagaactccgacgtcgt
tatcaacaacaacagcagcaacaagcatctactcaaactcggtacaatcgtcctcaaaat
ccagcgaatccttatccaacgtatcgacctcttccaacaagatcaacagtacaatctcca
cgacctgcatacaatccatattggcagtctccagtgacacaggctcctcatcacaattcc
catcaccatcatcatcaccatccacgtgtcagctcttcatcagaccctcaacaacgtcat
caatcacaacaacactatctagctcagacagtgtcaaatccaaaccgtcagaatgttaac
tatcaacgatacccgtga

DBGET integrated database retrieval system