KEGG   Caenorhabditis elegans (nematode): CELE_C05E4.9Help
Entry
CELE_C05E4.9      CDS       T00019                                 

Gene name
icl-1
Definition
(RefSeq) Malate synthase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
K01638  malate synthase [EC:2.3.3.9]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel00620  Pyruvate metabolism
cel00630  Glyoxylate and dicarboxylate metabolism
cel01100  Metabolic pathways
cel01200  Carbon metabolism
Module
cel_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:cel00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CELE_C05E4.9 (icl-1)
   00630 Glyoxylate and dicarboxylate metabolism
    CELE_C05E4.9 (icl-1)
Enzymes [BR:cel01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     CELE_C05E4.9 (icl-1)
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     CELE_C05E4.9 (icl-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase ICL PEP_mutase HpcH_HpaI
Motif
Other DBs
NCBI-GeneID: 178583
NCBI-ProteinID: NP_503306
WormBase: WBGene00001564
Ensembl: WBGene00001564
UniProt: Q10663
Position
V:complement(join(724457..724782,724835..726083,726152..726979,727385..727858,727928..727957))
Genome map
AA seq 968 aa AA seqDB search
MSSAAKNFYQVVKSAPKGRFKGIKRDYTVEDVLKLRGSIDIDYTLATRGANKLWQLLHTE
PFVPALGAQTGNQAVQMVRAGLKAIYLSGWQVAADANSAGDMYPDQSLYPANSGPELAKR
INRSLRRADQIEACEAEDYLAQRDWYAPIVADAEAGFGGALNCFELMKAYIEAGAAGVHY
EDQLGSEKKCGHMGGKVLIPTAQHIRHLNASRLAADVCGVPTIIVARTDAESSRLLTSDI
DPRDHPYIDYEAGRTIEGFYRLKDSTAIQYCIDRAIQYAPYTDLIWMETSHPTIADAREF
AEGVHKQYPDKMFAYNCSPSFNWKKHLSPSQMEKFQKELGAMGFKYQFITLAGYHANSYS
MFDLARNYKEKGMLAYSGLQEGEFAAEKHGYTAVKHQREVGTGYFDAVSRAVTGGLSSTT
ALSGSTEEAQFQTAVASQDEEILSLTAQNVAGDEKILTPDALRFLHDLNTEFNPRRLRLL
SKRNQVQADINNSLWFPDFNKETEVLRSDQGWKGAEIPRDLQDRRVEITGPTDRKMVINA
MNSGANVFMADFEDSNSPTWRNQLEGQINLYDAVRNNISYTHPTTKKEYTLNEKHAVLKV
RPRGWHLPEKHVLIHNQPTSGSLFDFGLFVFHNAKALIAQGSGPYFYLPKLQSAEEAQLW
ADVFKYTEDKLGLARGTIKCTVLIEHLLASFQLHEIIHALKDNIVGLNCGRWDYIFSYIK
TFQNHRKFLLPDRFQIGMTAPFMRNYSLEVIKACHLRGIHAMGGMAAQIPIKHDQVANDK
AFALVRADKEREATDGHDGTWVAHPGLVPLAKRVFDQMMPKPNQISKNLTRANCTKEDLT
VIPEGTRTEAGFRHNISVTLGYLDSWLRGTGCVPLYNLMEDAATAEISRAQLWQWLHHDA
KLEDGRTIDAGLVKQTIAAETERRLIRAGSVVNRIPEAADLLEKFVTEEKMSDFLTTDAY
DRLVSEGY
NT seq 2907 nt NT seq  +upstreamnt  +downstreamnt
atgagttctgcggctaaaaatttttatcaggtagtcaaatcggctccaaaaggccgcttc
aagggcatcaaacgtgactataccgtcgaagatgtgctcaaactccgaggctccatcgac
attgactacacccttgccacacgtggagccaacaaactctggcaactattgcacactgag
ccatttgtgccggctctcggagcccagactggaaaccaagcagttcagatggtcagagcc
ggattgaaggctatctacttgtccggatggcaggtggctgccgacgcaaactccgctgga
gacatgtaccccgatcagtctttatatccagcaaactctggcccggaattggcgaagaga
atcaacagatctttaagaagagcagaccagattgaagcctgtgaagccgaggactacctc
gcccaacgtgattggtacgcgccaatcgttgccgatgcagaagccggattcggtggagcc
ctgaattgcttcgagttgatgaaggcctatatcgaagccggtgcggcaggagttcactac
gaagatcagcttggatcggagaaaaaatgtggtcatatgggaggaaaagtcttgatccca
accgcccaacacattcgtcacttgaatgcgtctcgtttggctgctgatgtctgcggagtt
cctacaatcattgtcgcaagaaccgacgcagagtcctctagacttttgacatctgacatt
gatccaagagatcatccatacattgactacgaggctggaagaacgattgaaggattctac
agactcaaggattccactgcaattcagtattgtatcgatcgtgccatccaatatgctcca
tacaccgatctcatctggatggagacctctcacccaacgatcgccgacgcccgtgaattc
gctgaaggtgtccacaagcagtacccagacaagatgttcgcctacaactgctctccatcc
ttcaactggaagaagcatctgtccccatcgcagatggagaagttccagaaggagttggga
gctatgggattcaaatatcagtttatcacgcttgccggataccatgccaacagttatagc
atgtttgacttggccagaaactacaaggagaagggtatgctcgcctattccgggctccag
gaaggagagtttgctgctgagaagcatggatatacggcagtaaagcatcagagagaagtg
ggaaccggatacttcgacgctgtcagtcgtgcggttaccggaggactctcttcgactact
gccttgtcaggatccactgaagaagctcaattccagactgctgttgcttcgcaggatgag
gaaatcctttcgctcaccgcccaaaacgttgctggagacgagaagatcctcacaccagat
gctcttcgcttcctccacgacctcaacaccgaattcaaccctcgccgtttgagacttctc
tccaagcgcaaccaagttcaggctgatatcaacaactccctctggttcccagatttcaac
aaggagaccgaggtgctccgtagtgatcaaggatggaagggagccgagattccaagggat
ttgcaagatcgtagagttgagatcactggaccaaccgatcgtaagatggttattaatgct
atgaactctggagccaatgtatttatggctgacttcgaagattccaactccccaacatgg
agaaaccagcttgaaggacagatcaacttatatgatgctgtaagaaataacatctcctac
acccacccaactactaagaaggagtacacactgaatgagaaacacgccgttctgaaggtc
cgtccacgtggatggcaccttccagagaagcatgtcctcatccacaaccagccaacttca
ggatctctctttgatttcggactcttcgttttccacaatgccaaggccctcatcgcccag
ggctccggtccatatttctatcttccaaagcttcaaagcgccgaggaggctcaactctgg
gctgacgttttcaagtacaccgaggacaagctaggcctcgcccgtggaaccatcaagtgt
accgtgctcattgagcatttgctcgccagcttccaactccacgagatcatccatgccctc
aaggacaacattgtcggactcaactgcggacgttgggattacatcttctcctacatcaag
acgttccagaaccatcgcaagttccttctcccagaccgattccaaattggaatgaccgct
ccattcatgagaaactactccttggaagtcatcaaggcctgccatctccgtggtatccat
gccatgggaggtatggctgcccagattccaatcaagcacgaccaggtcgccaatgacaag
gcatttgccctagtcagagctgacaaggaacgagaggccactgacggacacgatggaaca
tgggttgctcatccaggattggtgccattggctaagagagttttcgatcaaatgatgcca
aagccaaaccagatcagcaagaatctcacccgcgccaattgcaccaaggaagacctcact
gtgatcccagagggaacccgcactgaagctggattccgccataatatctctgtaactctt
ggatacctcgactcttggctcagaggaaccggatgcgtgccactctacaacttgatggag
gacgctgccaccgccgaaatctcgcgtgctcagctctggcaatggctccatcatgatgct
aagcttgaggacggtcgcactattgacgccggacttgtcaagcaaacgattgccgccgag
accgagcgtcgtctcatccgagccggatcagttgtcaaccgaatcccagaggctgccgac
ttgctcgagaagtttgtcaccgaggagaagatgagcgacttcttgaccaccgacgcttac
gacaggcttgtctctgaaggatattag

DBGET integrated database retrieval system