KEGG   Caenorhabditis elegans (nematode): CELE_C06A8.6Help
Entry
CELE_C06A8.6      CDS       T00019                                 

Gene name
C06A8.6
Definition
(RefSeq) Uncharacterized protein
  KO
K17550  protein phosphatase 1 regulatory subunit 7
Organism
cel  Caenorhabditis elegans (nematode)
Brite
KEGG Orthology (KO) [BR:cel00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cel01009]
    CELE_C06A8.6 (C06A8.6)
Protein phosphatases and associated proteins [BR:cel01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CELE_C06A8.6 (C06A8.6)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LRR_4 LRR_9 LRR_8 LRR_6 LRR_5
Motif
Other DBs
NCBI-GeneID: 174253
NCBI-ProteinID: NP_495634
WormBase: WBGene00015516
Ensembl: WBGene00015516
UniProt: Q17692
Position
II:join(7772615..7772701,7772748..7773266,7773316..7773498,7773555..7773713,7773764..7773865)
Genome map
AA seq 349 aa AA seqDB search
MNVTSVTSEDGVKEFEKIVVEPEDIEYVEIPADAKNVDLTRHRIKEIGDYSWLTHVEHFS
FRWNLIKKIENLDCLTTLTHLEFYDNQITKVENLDSLVNLESLDLSFNRITKIENLEKLT
KLKTLFFVHNKITKIEGLDTLTELEYLELGDNRIAKIENLDNNLKLDRLFLGANQIRLIE
NVDHLKKLTVLSLPANAITVVDNISGLHNLKEIYLAQNGIKYVCGIDEHLPLEILDFNQN
RLEKVENIHQLKTLTDFWARGNKLDNWSIMDELVELPQLNSVYLDFNPIASVDTYRGKVI
HLLQQITRLDGTQCREHSMLRPPKEEKNETELSRVVLDNPSDDHPTESV
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtcaccagtgtcacttcagaggatggtgttaaagaattcgaaaagattgttgtg
gaacctgaagatatcgaatatgttgagattccggccgatgccaaaaacgttgacttgacg
cgtcaccgtatcaaagaaatcggtgattattcgtggctcactcacgtcgaacacttctcg
tttcgttggaatctgatcaaaaagattgaaaatctggattgtttgacaacgttgactcat
ctcgagttttacgataatcaaattacaaaagttgaaaacttggatagcctcgtcaatttg
gagtcactcgacctgtcattcaatcgtatcaccaaaattgaaaatttggagaagttgaca
aaactgaagactctcttttttgttcataacaaaatcactaaaatcgagggtttggatacg
ttgactgagctggaatatctcgaattgggtgacaatagaattgcgaaaatcgagaatctc
gacaacaatctgaaactcgatagattgttccttggcgctaatcagattcgtcttattgaa
aatgttgatcatttgaagaagctcacagttctcagtcttccagccaatgcgattactgta
gttgataacatttcgggacttcacaacttgaaagagatttatctggctcaaaatggcatc
aagtacgtttgtggaatcgatgagcatcttcctcttgaaattctggatttcaatcagaat
cgtcttgagaaggtcgagaatatccatcaattgaagacacttacagacttttgggcaaga
ggaaataagttggataactggagcattatggatgaattggttgaacttccacaactcaat
agtgtttacctcgatttcaatccaattgcatcagtggatacttatcgtggaaaggttatt
catctcttgcaacaaattactcgtcttgatggaactcagtgccgtgagcattcgatgctc
cgtccaccaaaagaagagaagaatgagacagagctttcgcgtgttgtacttgataatccg
tctgatgatcatcccactgagtccgtctaa

DBGET integrated database retrieval system