KEGG   Caenorhabditis elegans (nematode): CELE_C08G9.2Help
Entry
CELE_C08G9.2      CDS       T00019                                 

Gene name
C08G9.2
Definition
(RefSeq) Uncharacterized protein
Organism
cel  Caenorhabditis elegans (nematode)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thyroglobulin_1 WAP Lustrin_cystein Antistasin
Motif
Other DBs
NCBI-GeneID: 177545
NCBI-ProteinID: NP_501249
WormBase: WBGene00015620
Ensembl: WBGene00015620
UniProt: O44131
Position
IV:complement(join(7664272..7664493,7664561..7664622,7664671..7664939,7664988..7665114,7665158..7665390,7665440..7665893,7666073..7666270,7666316..7666478,7666527..7666724,7666840..7667041,7667092..7667530,7667583..7667885,7667937..7668283,7668327..7668738,7668783..7668948,7669002..7669174,7669221..7669334,7669380..7669543,7669593..7670166,7670251..7670430,7670478..7670910,7670957..7671060,7671108..7671299,7671360..7672052,7672511..7672580,7672697..7672879))
Genome map
AA seq 2224 aa AA seqDB search
MWLLYLLILKPFLSSSIDLLPASVPNVCPFRPTSCNLLCPFGYLKDILQQCICTCAMDPC
QTTICGPSESCIAIGVKARCIPKFGSNREECPRLTGGICALRCEKDSDCSGRLICCSNGC
GRECVAPIAKSFQIDREVPIQPVSSSSNNIPGSFQRLIKAVSNIGSTHFNITPIPPTIRN
LANSLFPTPSPIRPLPTTKVGQCPSPTSNKSICIDQKQCANDLDCGSVDKCCQNACGSTC
MEPLKATGCIHMVLAISKLKDKRLPNEFVPFCERNGRFSSIQCDIQFCWCVDVHYGSEIA
GTRISREQRRIDMCREPRLCTKKCHNQCTHGHVMDIFGCPIASCSCVDICRNVNCENTWE
QCQLVEPDCANPPCLPVPRCLLNPCRHGPPSRLGNGITALCSIDKDCPEGTCSKIGYNGL
GFCCSGPASSTRDGRCPSQAADKLKCLIYPDNSCHSDHECSEDEKCCFNGCTLSCTQPED
YVLKKPLKPIEPVMHYQPGDVEKYNKGHLSSLVADCIDIIASNVSCATECHSDSQCAGMK
RCCRQGCSTSCMYPVRSTPCFHLALTAELYSLRNAMKCDRAGNFEQYQCDDEGCFCVDIA
TGEELPGSRAIGRKPNCESRNPCEPLVCKVACPFGFERGSNSCPTCKCKNPCKEVKCPQG
SVCVMSSIQCYQKGNCVPQPRCVLNFCPAGEPYISSIGNAESCTKDEECPTSTHWCHKLG
LASGGMCCLSPPLVRHAGSCPIVPISLDAKMCRVSCKVDDDCSGHQKCCFDGCGAGCRDI
ATPLIEISKEIFEKAGTCISEQRVLCNRLEKNTCEYDTDCAGVAKCCDDGCVKACAYPLQ
TSKCLVRKTNLQKMGQMDLIKCRPDGSFEQIQCDTEFCWCVDEEGNYVEGTRTGEDITPN
CPEPCEKLECGTIGCEYGHKKDKRGCATCDCVDPCEGVTCGIDSLCVPTTVPCVTKPCPT
IPRCIINPCPISEAVKNETSLHLKKCYRSNDCFDAIMTTHCSMVTQEFGFCCTAESPETH
VGTCPKITDLNTAKVEKCIQECKTDSDCGQTSKCCWNGCGLTCVTSSISRIVPTPSIQQT
MPGTHFGECLNVAPLGAFCLQRPTIADCKNDDDCPSLYKCCSDGCVMRCTQPHRAPLCIH
QRIAALTIAKSEGVESNEKDSGVFIPDCDLNGNFDEVQSHFGLMWCVGRSGQEIAGTKST
RVPNCDDPRPCPTRFCAEQCPYGFNSDNEGCPICDCRSPCEFLNCPAGNVCRMIPVKCTT
PECRPVAKCIPNMCGTGEPLALENHLLATCSPISSCPAGYHCKNSGYGDISFCCSTPEVA
QQSLRCPVIPIMLASVDGSSCVVGCRHHYDCTHSSCCYNGCGTSCQFETRQLAIKPIKTL
KPFKPSKPSKTTRRPILSSLKIEKKASKIENVIVEHHAVLPVSPAPGKLGTCPKLLINPG
CTEQCSQDSDCHGFLKCCQASCGTMCSAPRIATACIHRLIAFESNIASEIVNLIIPPVQC
TPEGLFRKYQCDARLNQCWCVDKATGVEEIGTRLFTIGLQSPDCNLPKSCPTQCIGSRCP
YGIRTDGSGCPANGVCECINICSTFNCPQNMECALRRVECTSNPCPDVPFCVEVQCPIPQ
RDLYRNVILCENDGGCGKNSKCVLNPKTEMGICCHQKHTQSSVLNLISPAIVAAAPEVIE
ATTIVDRGNSPVVVEAVPMSLSTNCTTMRIALEYLHQNGAVLKSPLPVCSRNGNYDQTQC
DNKRCWCVDELSGEEIHGTRKKKTKNACKSQSMCLSKCSTSLCPYGLVLDSIGCPRSECI
CKSACEHVECPNAQVCILRKADCPNKWCLPVPTCEKSPCNSGLRPLIETRTRQQYSCTQS
TVCPVGYYCTAFDDNMHGVCCPGANSIKSIGEHNGLTCPHGDPFSSLADGTPFSCTVLTN
GCPATHYCSTMPGQKKGICCVSKRYVCNLQRDAGPCTATVTRFFYSSLTHSCTPFDYGGC
SGNLNNFATRDDCNNFCAGIGLDLSSPYDHASAPVPTESYQIAFTLSGGKIKSTKMQDAE
IQLINTLVERFKIPRGSIEDVILRDDNTVKFTIRDVDARRFAREVSEKVSTGEWTMTLSG
QKLTAEPHTLTASHVSNEHGRKNTAQVILYAILLAASIFLLCVICLIGFSCFCYYRNHPK
DRAHTPTNTTTITEPRSRQTGLRRVFSRDEISECSDFNRPPMHDVSMLNRDRGHPRSQSW
LSIG
NT seq 6675 nt NT seq  +upstreamnt  +downstreamnt
atgtggttactgtatcttttaattctgaaaccatttttgtcgtcttctatagacctttta
ccggcaagtgtaccaaatgtatgtcctttccgtccaaccagttgtaatttattatgccct
tttggatatttgaaagatattcttcaacaatgtatctgcacatgtgcaatggatccttgc
cagacgacaatttgtggaccatcagaaagttgcattgcaattggcgtgaaagcacgctgc
attccaaagttcggatcaaatcgagaagaatgcccacgattaactggtggtatatgtgca
cttcgatgtgaaaaagactctgattgtagtggtcggttgatctgttgctcgaacggatgt
ggacgagaatgtgttgctccaattgctaaaagttttcaaatcgacagagaagttccaatt
caaccagtttcttcatcatctaataacatccctggttcctttcaacgtctcattaaagct
gtatcaaatattggatcaactcatttcaatataactccaattccaccaacgatacgaaat
cttgcgaactctctatttccaactccttcaccaattcgtccacttcctacaacaaaagtc
ggtcaatgtccttctccaacatcaaataaatcaatatgcattgatcaaaaacaatgtgca
aatgatttggattgtggtagtgttgataaatgttgtcaaaatgcatgtggatcaacttgt
atggaacctctcaaagcaactggatgtattcatatggttctagcaatttcgaaattaaaa
gataaaagacttccaaatgaatttgttccattttgcgaacgaaacggacgattctcatca
attcaatgtgatattcagttttgttggtgtgtcgatgtacattatggctcagagatagct
ggtacaagaataagtcgagaacaacgaaggattgatatgtgtagagaaccccgtttatgt
acgaaaaagtgccacaatcaatgtactcatggacacgttatggacattttcggatgtcct
attgcatcatgttcttgtgtggatatttgtagaaatgttaattgtgaaaatacttgggag
cagtgtcagctggttgagcccgattgtgcaaatcctccatgtctccctgttccgcgatgt
ctgttgaacccatgtaggcacggaccaccttctcgtcttggaaatggaattacagcattg
tgttctattgataaagattgtcccgaaggaacttgttcaaagattggctacaatggactt
ggattttgttgttcgggtccagcgtcatctacacgagacggaagatgtccttcccaagcc
gctgacaaattaaagtgtctcatctaccctgataattcatgtcactcggatcacgaatgc
tctgaagatgagaaatgctgtttcaatggctgcactttatcttgcacacagcctgaagat
tatgttctgaaaaaaccattgaaaccaattgagccagtgatgcattaccaaccgggcgat
gttgagaagtataacaagggacatttgagctctttggtagcagattgtattgatatcatt
gcatcaaatgttagctgtgcaactgaatgtcattctgattctcaatgtgctggaatgaag
agatgttgtagacaaggatgttcaacttcgtgtatgtatccagttcggagcaccccttgc
tttcatcttgcattgacagctgaattgtattcattaagaaatgcaatgaagtgtgacagg
gcaggaaattttgaacaataccaatgtgacgatgaaggatgtttttgtgtggacatagca
actggagaagagctgcccggatcgcgagccattggaagaaaaccgaactgtgaaagtaga
aacccatgtgaaccactggtttgtaaagtagcatgcccatttggttttgaaagaggatca
aactcctgtccaacctgtaaatgcaaaaatccatgcaaagaagtaaaatgtccacaagga
agtgtatgcgttatgagctcaattcaatgttatcagaagggaaactgtgttccacaacct
agatgtgttctgaacttttgtccagccggagagccatatatttccagtattggaaatgct
gaaagttgtacaaaagatgaagaatgcccaacttcaactcactggtgtcataaacttgga
ttggcatctggaggaatgtgttgcctatctccacctcttgtccgtcatgcaggttcttgt
ccaattgttcctataagtttggacgcaaaaatgtgcagggtttcttgtaaagttgatgat
gattgtagtggacatcaaaagtgttgctttgatggatgtggggcaggatgcagagatatt
gcaactcctctaattgaaatatccaaagaaatatttgagaaagctggaacttgtatttct
gaacaacgtgttctttgtaacagactagaaaaaaatacctgtgaatatgatactgattgt
gctggagttgccaaatgttgtgacgatggatgtgtgaaagcgtgtgcttatcctctacaa
acaagcaaatgtcttgttcgaaaaacaaatctacaaaagatgggacaaatggatttgatc
aaatgcaggccagatggatcgtttgagcaaatacaatgtgacactgaattttgttggtgc
gtggatgaagaaggaaattatgtagaagggaccagaactggagaagatattacaccaaac
tgtccagaaccatgtgaaaaacttgaatgtggtacaattggatgcgagtatggacataaa
aaagataaaagaggatgtgcaacgtgtgattgtgtagatccatgtgaaggtgtcacctgt
ggaatagattctctgtgtgttccaactacagttccatgtgttacgaagccatgtccaacg
atccctcgatgtatcataaatccttgtccaatttctgaagcagtcaaaaatgagacatca
cttcatttgaagaagtgttacagaagtaatgattgctttgatgcaattatgactacgcat
tgttctatggttacacaggaatttggattttgttgtacagctgaatcacctgaaacacac
gtgggcacgtgtccaaaaataacagacctaaacactgcaaaagttgaaaaatgtattcaa
gaatgcaaaaccgactccgactgtggacaaacttcaaaatgttgttggaatggatgtggg
ctgacatgtgtaacttcatctatatctcgcattgtacctactccttcaatacaacaaaca
atgcccggaactcattttggagagtgcctgaatgttgctccacttggagcattttgtctt
caacgacctacaattgcagactgtaaaaatgatgatgattgtccttcattgtataaatgt
tgttctgatggttgtgtcatgagatgtactcaacctcatagagctcctctttgtattcat
caaagaattgctgcattgacaattgcaaaaagtgaaggggtcgagtcaaatgaaaaagat
tcgggagttttcattcccgattgtgatttgaatggaaactttgacgaagtgcaatctcat
tttggtcttatgtggtgtgtaggtagatcaggtcaagagatcgctggtaccaaatcaaca
cgagttccaaattgtgatgatcctcgaccttgtccaacaagattttgcgccgaacaatgt
ccgtacggattcaacagtgataatgaaggatgtccaatttgtgactgcagatctccatgc
gaatttttgaactgtcccgctggaaatgtctgccgaatgattccagttaaatgtactaca
ccggaatgtcgaccagttgcaaagtgtattccaaatatgtgtggaactggagaaccgctt
gctcttgaaaatcatctccttgccacgtgttcaccaatttcatcttgccctgctggatac
cattgcaaaaacagtggatacggtgatatatcattttgttgttcaactcccgaagttgct
caacaatcactcagatgtcctgttattccgataatgcttgcttctgttgatggatcatct
tgtgttgtaggatgtagacatcattatgattgtactcattcgtcatgttgttataatggt
tgcggtactagttgccaatttgagacaagacaactagcaattaagccaatcaaaacattg
aaaccattcaagccatcaaaaccttcgaaaacgaccagacggcccattctcagctcatta
aaaatcgagaagaaagcttcaaaaattgaaaacgttattgtggagcatcatgcagtttta
ccagtttctccagctcctggaaaacttggaacatgcccaaagctcctcataaatcctgga
tgtacagaacaatgtagtcaagattcggattgccatggatttttgaaatgttgccaagct
tcatgtggaacaatgtgttctgctcccagaattgcgactgcttgtattcatagacttatt
gcttttgagtcaaacattgcatctgaaattgtgaacttgattattcctccagttcaatgt
actcctgaaggcctcttcagaaagtatcaatgtgatgctagattaaatcaatgttggtgt
gttgataaggcaacaggagttgaagaaataggaactcgtctgttcacaatcgggcttcaa
tcaccagactgtaatttaccgaaatcatgtcccactcaatgcattggaagtagatgtcct
tacggcatcagaactgatggaagtggatgtccagcaaacggggtttgcgagtgtattaac
atttgtagtactttcaattgtccccagaatatggaatgtgcacttcgacgtgtagaatgt
acatcaaacccgtgcccagatgtaccattctgcgttgaagttcaatgtccaattccacaa
cgagatttgtatcgaaatgttattctgtgtgaaaatgatggaggttgtggcaagaactca
aaatgtgtattaaacccgaaaacggagatgggaatatgttgtcatcagaagcatacacag
tcatccgtacttaatctgatatccccggcaattgtggcagcagctccggaagttatcgag
gcaacaacgatcgtcgaccgagggaactcaccagtggtcgtcgaagcagttccgatgtct
ctttcaacaaattgtacaacaatgcgaatagcccttgaatacctacaccagaacggcgca
gttctaaaatccccactaccagtatgcagtagaaatggaaactacgatcagacgcaatgc
gacaacaaacgatgttggtgtgtcgatgaattgagtggagaagagattcatggaacacga
aagaagaaaacaaagaatgcgtgcaagtcgcagtcaatgtgtctatcaaaatgttcgacc
agtctttgcccatacggtcttgttcttgattcaatcggttgtccaagatcagaatgtatt
tgtaaatcagcatgtgaacatgttgagtgtcccaatgcgcaagtctgtatactacgaaaa
gctgattgtccaaacaaatggtgcctcccagtaccaacttgtgagaaatctccctgtaac
agtggattgcgtcctcttatagagacacgaacccgacaacaatactcgtgtacgcagagt
acagtttgtccagttggatattattgtactgcatttgatgataatatgcatggtgtttgt
tgtcctggagcaaattctatcaaaagtatcggagaacataatgggcttacatgcccccat
ggagatccattctcatcactcgcagacggcacaccattctcatgtactgtactgactaac
ggatgcccagcaactcattactgttcaacaatgcctggccaaaagaagggaatttgttgt
gtttcaaagagatatgtatgtaatcttcaaagagatgctgggccatgtaccgcaacagta
acaagattcttctactcttctcttactcattcctgtactccatttgattatggtggatgc
tctggaaacttaaacaattttgctactcgtgatgattgcaataatttctgtgcaggaatt
ggtttggatctgtcttctccttatgatcatgcaagtgctcctgtaccaaccgaatcttat
caaattgctttcactctttctggtggaaaaattaaaagcacaaaaatgcaagatgctgaa
atccaacttatcaacacactggttgaacgtttcaaaattccacgtggaagcattgaagat
gtaattcttcgggatgacaacactgtcaaattcacaattcgtgatgttgatgctcgacgg
tttgcaagagaagtatctgaaaaagtgtcaactggtgaatggacaatgaccctctctggg
caaaaactgacagcagagcctcatacgttgacagcttcacatgtttcaaacgagcacgga
aggaaaaatacggcccaggttatcctttatgcaatattactcgcagcttcaatcttcctt
ctgtgtgttatctgtctaattggtttttcttgtttctgctactacagaaatcatccaaaa
gatagagctcacactccgaccaacactacaacaataactgaacctcgaagtcgtcaaact
ggacttcgtcgggtattttcacgagatgaaatatcagaatgttctgattttaatcgtcct
ccaatgcacgacgtttcaatgctcaaccgtgatagaggacatcctcgttcacaaagttgg
ctctcaatcggttaa

DBGET integrated database retrieval system