KEGG   Caenorhabditis elegans (nematode): CELE_C13B9.2
Entry
CELE_C13B9.2      CDS       T00019                                 

Gene name
C13B9.2
Definition
(RefSeq) Uncharacterized protein
  KO
K11529  glycerate 2-kinase [EC:2.7.1.165]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel00030  Pentose phosphate pathway
cel00260  Glycine, serine and threonine metabolism
cel00561  Glycerolipid metabolism
cel00630  Glyoxylate and dicarboxylate metabolism
cel01100  Metabolic pathways
cel01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cel00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    CELE_C13B9.2 (C13B9.2)
   00630 Glyoxylate and dicarboxylate metabolism
    CELE_C13B9.2 (C13B9.2)
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    CELE_C13B9.2 (C13B9.2)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CELE_C13B9.2 (C13B9.2)
Enzymes [BR:cel01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.165  glycerate 2-kinase
     CELE_C13B9.2 (C13B9.2)
SSDB
Motif
Pfam: DUF4147 MOFRL
Other DBs
NCBI-GeneID: 266887
NCBI-ProteinID: NP_498462
WormBase: WBGene00015733
Ensembl: WBGene00015733
UniProt: Q09235
Position
III:join(6620267..6620344,6620802..6621305,6621355..6621547,6621593..6622194)
AA seq 458 aa
MATRKAVRTAFEKCLLAVEPRSIVRNAISLNPSLLKIADYNYSLSNSTKIVVIAFGKASI
LMAKGARDQLKSSLLQKTIVIAPEQQKGIENELENDTEILYGARDNLPDEKSVFATRKVI
SEIRDFDSESTIFLFLISGGGSALLTSPSAPLDLAEKLETIRIMQAHGATIQELNTIRQN
LSDVKGGKLLREIKKGCSIALIISDVIGNPVELIASGPTVIPAHQQDKFIISNILESLKI
NKLELPVNVKNVLENHEKEQLPENTSRFQNFIISSNNFALRAAAEYLTSSGYNSTIVTSS
LSGNAAEIGKKFAEIITEKSITSSHLLKNSNLTIENYPIALLFGGETTVHLSENPGKGGR
NQEMVLSCLDALKTRVPAHNFTFLSAGTDGQDGPTDAAGAIISNEDLPLNSLLNSSEFLQ
NSDSYNFWRQFKGGANHILTGPSGTNVMDIQILLLDQL
NT seq 1377 nt   +upstreamnt  +downstreamnt
atggctactcgaaaagcagttagaacagcttttgagaaatgcctgttggctgtggagccc
cgttcaattgtcagaaatgcaatctccttgaatccgtccttattgaaaattgctgattac
aactattcattgtctaattccactaaaatcgtcgtaattgcattcggaaaagcatcgatt
ctaatggcaaaaggagcaagagaccagctcaagtcatcacttttacagaaaacaattgta
attgcaccggaacaacaaaaaggaattgaaaatgaattagaaaatgacactgaaatatta
tacggagcaagagataatcttcctgatgagaaatcagtttttgcgacccgaaaagtcatt
tctgaaattcgagatttcgactctgaatccacgatttttctttttctaatttccggtgga
ggttcagctttattgacttcacccagtgctccattggatttggctgaaaaattggaaact
ataagaattatgcaagcacatggggctacaattcaagagctgaataccattaggcagaat
ctctcagatgtgaaaggtggcaaacttttgagagagattaagaaaggatgctccattgcg
ctcatcatatctgacgtcatcgggaatcctgtggagctcattgccagtggacctacagta
atccctgcccatcaacaagacaagttcatcatttccaacattttagaaagtttaaaaatt
aataaactggaacttccggtaaatgtgaaaaatgtattggagaatcatgaaaaagaacaa
ctccctgaaaatacttcacgtttccaaaacttcataatttcaagcaacaactttgctctt
cgagcggctgctgaatatttaacttcttctggttataattcaacaattgtgacgtcatca
ttgtctggaaatgctgctgaaatcggaaaaaagtttgctgaaattattactgaaaaatca
ataacttcgagtcatcttttaaaaaactcgaatttaactatcgaaaattatccaattgct
ctactttttggtggtgagacaactgttcatttgtctgaaaatccaggaaaaggaggtcgc
aatcaggaaatggtactgagctgtctggatgctttgaagacgcgagttccagctcataat
ttcacttttttgagtgctggaactgatggacaagatggacctacggatgctgccggagca
atcataagcaatgaagatttgcctttaaattctcttctcaacagttcggaatttttgcaa
aattcggattcctataatttttggagacaattcaaaggaggagcgaatcatattttaact
ggaccaagtggaactaatgtgatggatattcagattttgcttctagatcagctctaa

DBGET integrated database retrieval system