KEGG   Caenorhabditis elegans (nematode): CELE_C14A4.5Help
Entry
CELE_C14A4.5      CDS       T00019                                 

Gene name
crn-5
Definition
(RefSeq) Cell-death-Related Nuclease
  KO
K12590  exosome complex component RRP46
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel03018  RNA degradation
Module
cel_M00391  Exosome, eukaryotes
Brite
KEGG Orthology (KO) [BR:cel00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    CELE_C14A4.5 (crn-5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:cel03019]
    CELE_C14A4.5 (crn-5)
Messenger RNA biogenesis [BR:cel03019]
 Eukaryotic Type
  mRNA degradation factors
   3'-5' decay
    Core exosome factors
     CELE_C14A4.5 (crn-5)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNase_PH RNase_PH_C
Motif
Other DBs
NCBI-GeneID: 174634
NCBI-ProteinID: NP_496284
WormBase: WBGene00000798
Ensembl: WBGene00000798
UniProt: G5EG59
Structure
PDB: 

Position
II:join(10592762..10592965,10593012..10593178,10593226..10593499)
Genome map
AA seq 214 aa AA seqDB search
MAGRLREMRCELSFLKNADGSACFSQGATCIWASCSGPGDVHASKASDEAMTLDISYRAN
CGDNKFNVLNNIIHSTLSNAINLELFPHTTISVTVHGIQDDGSMGAVAINGACFALLDNG
MPFETVFCGVLIVRVKDELIIDPTAKQEAASTGRVLFSVCKGSDGHPEVCAMDAIGHWDF
IQLEAAWSLAQPSASAIFDFYKTVMKRKLSVDEQ
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atggccggcagacttcgtgaaatgcgttgtgagctctcgttcctcaaaaacgcggatggc
tcggcatgcttctcccagggtgccacgtgtatttgggcttcatgcagtggtcctggagat
gttcacgcttcgaaagcaagtgatgaggctatgactctggatattagttatagagcaaat
tgtggagataacaagttcaatgtgctgaacaatatcattcattctactctatccaatgca
atcaatctcgaattgtttccccacacaacaatttctgtcacagtacatggaattcaggat
gatggaagtatgggagctgtagcgataaatggagcttgttttgctctacttgacaatgga
atgccattcgaaacagtcttctgtggtgtccttattgttcgtgtcaaagatgagctgatt
attgatccgacagcaaaacaagaagctgcatcgactggaagagtgctcttttcagtgtgc
aaaggatccgatggacatccagaagtgtgtgcgatggacgctataggacattgggatttt
attcagctggaagccgcgtggtcattggcacaaccatctgccagtgctatttttgatttc
tacaaaactgtgatgaagaggaagctttcggttgatgagcaatag

DBGET integrated database retrieval system