KEGG   Caenorhabditis elegans (nematode): CELE_C16A11.4Help
Entry
CELE_C16A11.4     CDS       T00019                                 

Gene name
C16A11.4
Definition
(RefSeq) Uncharacterized protein
Organism
cel  Caenorhabditis elegans (nematode)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SPK PHD
Motif
Other DBs
NCBI-GeneID: 173755
NCBI-ProteinID: NP_494744
WormBase: WBGene00015817
Ensembl: WBGene00015817
UniProt: O76580
Position
II:join(4227057..4227640,4227693..4228256,4228538..4228910,4228960..4229022)
Genome map
AA seq 527 aa AA seqDB search
MDDSSEEANQFEPPPAIRKSTRAVNNLSPHQKEVRCQCGTNNTDNRLIKCVECEKWQHAI
CMSVMPLDIIMTYKCEMCEPRLLMVSRSQARAYQGVEPEPREVRKKGRNQSVNLEEFLEF
LSEASENISRPLALTTLFEDYKEHINYPQSVRILRKQLESNLLETISMSPNYYADRKAQM
LFAMGLRVKGEFLERLERNAVVEVDGYHRITFYKSKNLEFRGKHRVGRFPLVNRRKSAES
TSQQHGNSGEEDDDDIFIDLVVPVTGNSRWNQFPVKQEIPDEQSFGSASTLPNAEIEPNL
QYSLSDTMTTGSASTWNMAATPPSEMRGIMMESMNGLHALQSASYPPYQEMQEMLCVQHT
MMKSMHEIIKTQSDFYREMFKTRAIAGAPPAPATTSLRAFLHFLKGYVDYLESEQLVDCS
RLTQQHLETCRAADKLISMEKLLTGLAVATTIAEAHLSDVSAIINGASAMEFYKFIEIYA
SNQSNSAFSGLCTDLKQKIQALVNMDKKIPFKELSRAFRTAISLVSQ
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atggacgattcttcagaagaagcgaatcagtttgagccaccgccagctatccgaaagtcc
accagagcagtcaacaatctgtcgcctcatcaaaaagaagtcagatgtcaatgcgggaca
aataacacggataatcggctcataaagtgtgtagagtgcgaaaagtggcagcacgctatc
tgtatgagtgtcatgccgttggatatcataatgacctacaaatgcgagatgtgtgagcca
agattgctgatggtctccagatcccaggcgagagcataccaaggagttgagcccgagccc
agggaagtccggaagaaaggaagaaaccaatcggtgaatttggaggagttcctcgagttc
ttgtcggaagcatccgaaaatatcagtcgtccacttgcgctgactacactgttcgaagac
tacaaagaacacatcaattatccgcaatcagtgagaattctccgcaagcagctcgaatca
aatctcttggagacaatctcaatgtcacccaattactatgccgatcgaaaagcgcaaatg
ctcttcgcgatggggttacgcgtcaagggcgagttcttggaaaggctggagaggaatgca
gtggtggaagtggacggttaccatcgaatcactttctataagtcgaagaatttggagttc
agaggaaaacatcgcgtcggcagatttccacttgtaaatcgtcgaaaatctgcagaaagt
acttcacaacagcacggaaattcgggtgaagaagacgatgatgacattttcatagatcta
gttgttccagttacaggcaattcaagatggaatcagtttcctgtgaagcaggagattccc
gatgagcagagttttggttcagcaagtactttgccgaacgccgagattgagccaaatctt
caatactcattgagcgataccatgacgactggttccgcgagcacttggaacatggcagcc
actccaccaagcgaaatgcgaggaatcatgatggaatcgatgaatggtttgcacgctcta
caatctgcgagttatccgccttaccaagaaatgcaggaaatgctatgcgtgcagcacacc
atgatgaaatcgatgcatgaaataatcaaaacgcaatccgacttttacagagagatgttt
aagacgagagcgatcgccggcgcaccacctgccccagcaaccaccagtctccgcgccttt
ctgcattttctcaaaggctatgtcgactacctggaatccgagcagctggttgactgcagc
cgcctgactcaacagcacttggagacttgccgagcggctgacaagctgatttcaatggaa
aaactgctaacggggcttgccgtcgcaacaaccatcgctgaagcacatctatcggatgtt
tcagccatcatcaacggggcttctgccatggaattttacaaattcatcgagatttacgca
agtaatcagagcaattcggcattttcgggcctttgcaccgatctgaagcaaaagattcag
gctcttgtaaatatggataagaaaattccattcaaagagttgagccgtgccttccgaact
gcaatctccctggtttctcaatga

DBGET integrated database retrieval system