KEGG   Caenorhabditis elegans (nematode): CELE_C18C4.10
Entry
CELE_C18C4.10     CDS       T00019                                 

Symbol
klc-2
Name
(RefSeq) Kinesin light chain
  KO
K10407  kinesin light chain
Organism
cel  Caenorhabditis elegans (nematode)
Brite
KEGG Orthology (KO) [BR:cel00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:cel03019]
    CELE_C18C4.10 (klc-2)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:cel04812]
    CELE_C18C4.10 (klc-2)
Messenger RNA biogenesis [BR:cel03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     CELE_C18C4.10 (klc-2)
Cytoskeleton proteins [BR:cel04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     CELE_C18C4.10 (klc-2)
SSDB
Motif
Pfam: TPR_12 TPR_10 TPR_7 TPR_1 TPR_2 TPR_8 TPR_16 TPR_MalT TPR_14 TPR_19 TPR_17 ANAPC3 PPR RNPP_C SHNi-TPR TPR_11 PPR_2 GlfT2_domain3 RPN7 DUF2225 Crescentin
Other DBs
NCBI-GeneID: 178942
NCBI-ProteinID: NP_001023663
WormBase: WBGene00002215
Ensembl: WBGene00002215
UniProt: P46822
Position
V:complement(join(5576653..5576694,5577888..5577996,5578047..5578966,5579018..5579334,5579387..5579529,5581304..5581341))
AA seq 522 aa
MNLAGSTIQAYRQRKIESLAKMSNMSQDDVTTGLRTVQQGLEALREEHSTISNTLETSVK
GVKEDEAPLPKQKLSQINDNLDKLVCGVDETSLMLMVFQLTQGMDAQHQKYQAQRRRLCQ
ENAWLRDELSSTQIKLQQSEQMVAQLEEENKHLKYMASIKQFDDGTQSDTKTSVDVGPQP
VTNETLQELGFGPEDEEDMNASQFNQPTPANQMAASANVGYEIPARLRTLHNLVIQYASQ
GRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKEAANLLNEALSIRE
KCLGESHPAVAATLNNLAVLFGKRGKFKDAEPLCKRALEIREKVLGDDHPDVAKQLNNLA
LLCQNQGKYEEVEKYYKRALEIYESKLGPDDPNVAKTKNNLSSAYLKQGKYKEAEELYKQ
ILTRAHEREFGQISGENKPIWQIAEEREENKHKGEGATANEQAGWAKAAKVDSPTVTTTL
KNLGALYRRQGKYEAAETLEDVALRAKKQMSESRRMERSVMY
NT seq 1569 nt   +upstreamnt  +downstreamnt
atgaatttggccggttctactattcaggcatatcgccagcgaaaaatcgagtcgctggcg
aaaatgtcaaacatgtcgcaggacgacgtgacgacgggcctacgtaccgttcagcaggga
cttgaagctcttcgtgaggaacactcgacaatttcgaatactttggagactagtgtcaaa
ggtgtgaaagaagatgaagctccattgccgaagcagaagctttcacaaattaacgataat
ttggataagttggtgtgcggagttgatgagacatcgttgatgctgatggtattccaactc
actcaaggaatggatgctcaacatcagaaataccaagctcaacggagacgcttgtgccag
gagaatgcgtggcttcgtgatgagttgagttcaactcaaatcaaacttcaacagtcggag
caaatggttgctcaattggaagaggagaacaagcatcttaagtatatggcatcaatcaaa
caatttgatgatggaactcaaagtgatactaagacatctgtcgatgttggaccacaacca
gtcacaaacgaaactcttcaagaacttggttttggaccagaagacgaagaagatatgaat
gctagtcaattcaaccaaccaacaccagccaaccaaatggcggcttctgctaatgttgga
tacgaaattccagctcgtcttcgcacacttcacaacttggtcattcaatacgcctcccaa
ggtcgttatgaagttgcagttccattgtgcaagcaagctttggaagatttggagaaaacg
agtggtcacgatcatccagatgttgccacaatgctcaatattttggcacttgtctacaga
gatcagaacaagtacaaagaggctgcaaatcttctgaatgaggctctcagtattcgtgag
aaatgtcttggagaaagtcatccagctgttgccgccactctcaacaatctcgcagttttg
ttcggaaaacgtggaaagttcaaggatgctgaaccgctttgcaagcgtgctcttgaaatt
cgcgagaaagttcttggagatgatcatccagatgtggccaagcaactcaataatcttgct
cttctttgccaaaatcaaggaaagtatgaagaagtcgagaagtattacaagagagctctc
gaaatctacgagagcaaacttggacctgatgacccgaatgtggcaaagaccaagaacaat
ttgtcatctgcttacttgaaacaaggaaaatataaggaggctgaggagttgtacaagcaa
attctcaccagagctcatgaaagagagttcggacagatcagtggagagaataaaccaatt
tggcaaatcgctgaagaacgagaggagaacaagcacaagggagaaggtgcaactgccaac
gaacaagctggatgggcaaaagccgccaaagttgatagtccaaccgtcacaacaactctc
aagaaccttggagccctttaccggcgacaaggaaaatatgaagccgccgaaacattggaa
gatgtcgccttgagagcaaagaaacagatgtccgaatctcgaagaatggaacgatccgtt
atgtattga

DBGET integrated database retrieval system