KEGG   Caenorhabditis elegans (nematode): CELE_C18D11.4
Entry
CELE_C18D11.4     CDS       T00019                                 

Gene name
rsp-8
Definition
(RefSeq) RRM domain-containing protein
  KO
K12897  transformer-2 protein
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:cel00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    CELE_C18D11.4 (rsp-8)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cel01009]
    CELE_C18D11.4 (rsp-8)
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:cel03041]
    CELE_C18D11.4 (rsp-8)
Protein phosphatases and associated proteins [BR:cel01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CELE_C18D11.4 (rsp-8)
Spliceosome [BR:cel03041]
 Common components
  Common spliceosomal components
   SR proteins
    CELE_C18D11.4 (rsp-8)
SSDB
Motif
Pfam: RRM_1
Other DBs
NCBI-GeneID: 176613
NCBI-ProteinID: NP_001255142
WormBase: WBGene00004705
Ensembl: WBGene00004705
UniProt: Q9XTZ2
Position
III:join(11826431..11826481,11826862..11826926,11828725..11829046,11829898..11830181,11830521..11830728)
AA seq 309 aa
MGHRSRSNSRSQSRSRENSRGRSRSASKSPVYHRRERESSRSRSPRARYGGGGGGGGGGG
RGRNQQYDRENPQPSKCLGVFNLSSYTTEKDLRDVFGEFGEINKCDLVYDRPSGNSRGFG
FIYFNLIEDATAARDKLCNTDLDGHKIRVDFSLTKRGHSPTPGQYMGDRRGGGSSGGGRF
GGGGGDRFNDRGSRGGDRYGGDRRGGGGGGGGDRYGGGGGDRYGGDRYGGGGGRRGSPDR
RGGFRSGGGGGGYMRSGGGGGGPDRRDHRDNDRNGGGGGHRPYDPSFRRRVESYGSGNSG
GGGGRRDRY
NT seq 930 nt   +upstreamnt  +downstreamnt
atgggccatcgttcgcgtagcaatagcagatcgcaatcacgttctcgagagaattctcgt
ggacgctccagatcggcttcaaagtcaccagtatatcatcgcagggaacgcgagagctcc
cgttcccgttctccacgtgctcgatacggaggtggtggtggtggcggtggcggtggtggc
cgcggccgtaaccaacagtatgatcgtgaaaatccacagccatcaaagtgcctcggagta
ttcaatctgtcttcgtacacaactgaaaaagacttgcgcgacgtgttcggcgagtttgga
gagattaacaagtgcgatctggtctacgatcgtccatcgggaaattcacgtggattcggc
ttcatttactttaatttgattgaggatgcgacagcggcgagggataagctgtgcaataca
gatttggatggtcataagattcgcgtcgacttttccttgacaaaacgcggccattcacca
actcctgggcaatacatgggagatcgtcgtggtggaggcagcagcggtggcggtcgattc
ggcggtggcggaggagatcgattcaacgatcgaggatctcgtggtggtgatcgctatggt
ggagatcgtcgtggtggcggcggcggcggcggtggtgatcggtacggtggaggtggtgga
gatcgttatggaggtgatcgatatggtggtggtggtggacgtagaggttctccggacaga
cgtggcggattccgtagtggaggcggcggtggtggatacatgagaagcggtggcggtgga
ggaggaccagatcgtcgtgatcatcgagacaacgatcgaaacggtggaggtggtggacac
cgtccgtatgatccatcgttcagacgtcgcgtcgaatcgtacggatctggaaatagcggt
ggtggcggcggacgtcgtgatagatattaa

DBGET integrated database retrieval system