KEGG   Caenorhabditis elegans (nematode): CELE_C18E3.2Help
Entry
CELE_C18E3.2      CDS       T00019                                 

Gene name
swsn-2.2
Definition
(RefSeq) SWI/SNF nucleosome remodeling complex component
  KO
K11650  SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D
Organism
cel  Caenorhabditis elegans (nematode)
Brite
KEGG Orthology (KO) [BR:cel00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:cel03021]
    CELE_C18E3.2 (swsn-2.2)
   03036 Chromosome and associated proteins [BR:cel03036]
    CELE_C18E3.2 (swsn-2.2)
Transcription machinery [BR:cel03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    BAF/PBAF complex
     CELE_C18E3.2 (swsn-2.2)
Chromosome and associated proteins [BR:cel03036]
 Eukaryotic type
  Chromatin remodeling factors
   BAF complex
    CELE_C18E3.2 (swsn-2.2)
   PBAF complex
    CELE_C18E3.2 (swsn-2.2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SWIB
Motif
Other DBs
NCBI-GeneID: 172018
NCBI-ProteinID: NP_491329
WormBase: WBGene00015971
Ensembl: WBGene00015971
UniProt: O02101
Position
I:join(4210997..4211047,4211116..4211259,4211307..4212391,4212443..4212512)
Genome map
AA seq 449 aa AA seqDB search
MHSQQRPNPQMNRHPYGTPGSAPQMRRPGGFAGQPPQMHGPRMVAPPAAPLPKKKKYADK
CIHPKIRELEPDAENYMALLASEQKLDSTLSRKKLDIQEALKRPSKVKKRLRIYISHTFI
EEKQPEKDTDEASLPMWELRVEGRLLDEQPPAPAIPGQRPVPKRKFSSFFKSLVIELDKE
MYGPDQHLVEWHRTPQTNETDGFQVKRAGDRPVKCRILLLLDNHPAKFKLHPRLAKVLGI
ATETRPKIIEALWQYIKTHGLQDPQERDIINCDTFLSQCFGVNRMRFMEVPNKLHQLLQQ
TDPLEFNHIIQRPKEGQEQVSTCYDIDVEMEDPVKQFMHTFVHSPGLANDIQTLDQKCYD
IIEQINELKTRRDFYARFYTEPAEFIKSWVMSQNSDLKTMNELSGDLEAERFAESYVRPE
TEEGVQRYMFQKVNQKRHELEQSLGVRSN
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgcattctcaacagcgcccgaatccccagatgaataggcacccctatgggacaccagga
agtgctccacaaatgcgacgcccgggaggttttgctggtcagccgccacaaatgcatggg
cctcgaatggttgcaccgccggctgctccattgccgaaaaagaagaagtatgcggataaa
tgtattcatccaaagattcgcgagcttgagccagacgcagaaaactacatggcactcctg
gcctctgagcagaagcttgattcaacgctctctcgaaagaagttggatattcaagaagct
ctgaaacgcccgagtaaagtcaagaagcgtcttcgtatttacatttctcacacttttatc
gaagagaagcaaccggagaaagatactgatgaagcttctctcccgatgtgggaacttcgt
gttgaaggacggcttctcgatgagcagccaccggctcctgccattccaggccaaagacca
gttccgaaaagaaaatttagttcatttttcaagtctctggttattgagcttgacaaagaa
atgtacggaccggatcagcatcttgttgagtggcatcgcacaccacaaaccaacgaaact
gatggattccaagtgaaacgagccggcgatcgtcctgtcaagtgcagaatcctcttgctg
ctcgacaatcatccagcgaaattcaagcttcatccacggcttgccaaagttctcggaatt
gctacagaaactcgtccgaagattatcgaagctctctggcagtacatcaaaactcatgga
cttcaagatcctcaagaacgggacattatcaattgtgatacatttttgagtcaatgtttc
ggagtgaatagaatgagatttatggaagtgccaaacaaattgcatcaactacttcaacaa
actgatccattggagttcaatcatataattcaacgaccaaaagaagggcaggaacaagta
tcaacttgctacgacattgatgttgagatggaagatccagtgaaacagtttatgcatact
ttcgttcatagtccaggacttgccaatgatattcaaactcttgatcaaaagtgttatgat
attatcgaacagatcaacgaactgaagactcgccgcgatttctacgcaagattctacacc
gaacccgcagaattcatcaaaagctgggtgatgagccagaattcggacctgaagactatg
aacgagctgagcggggatcttgaggcagaacgattcgctgaatcctacgtgagacctgaa
acagaggaaggagttcaaagatacatgttccaaaaggtgaaccagaagcgacacgagttg
gagcaaagtcttggtgttcgatcaaattaa

DBGET integrated database retrieval system