KEGG   Caenorhabditis elegans (nematode): CELE_C18H7.3Help
Entry
CELE_C18H7.3      CDS       T00019                                 

Gene name
col-102
Definition
(RefSeq) COLlagen
Organism
cel  Caenorhabditis elegans (nematode)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Collagen Col_cuticle_N Orai-1
Motif
Other DBs
NCBI-GeneID: 182802
NCBI-ProteinID: NP_499957
WormBase: WBGene00000676
Ensembl: WBGene00000676
UniProt: Q9GZF7
Position
IV:join(604444..604693,604744..605876)
Genome map
AA seq 460 aa AA seqDB search
MTQAVLGVVNTVTAVSVITAILLSVAILVDINNFSDEVSQDLTQFRGYYDDAWRTMMVNE
GMKGLTARISRQAGYATGGSQQCNCGSQAAGCPAGPPGAAGEDGTPGEPGTDGEDGGNGM
PGVAQMAMDANGGACIKCPAGEPGPPGPEGPAGPAGPAGNAGADGEAGAEGPAGEAGPPG
PPGPDGKPGAAGSDGEAGAPGTKTTNAPGEPGPAGPPGPPGPNGEAGAGSGPGPEGPAGP
PGPNGKDGEAGAPGKDGDAGADGAPGTDAAYCPCPPRSAALGAGGGAEPAGAAPEAAAAA
PEAAPEAAPAAEGAGGGAEPAGAAAPDAAAAAPEAAPAEAAPAAEGAGGGAEPAGAAPDA
AAAAPEAAPAEAAPAAEGAGGGAEPAGAAAPDAAAAAPEAAAAPEAAPAAEGAGGGAEPA
GAAPEAAAAAPEGAGGGEAPPTNGKGGEASPAYPTGQSSY
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgacacaagctgttctgggagtggtcaacactgtgacagccgtttcggtaatcacagca
attcttttatctgttgcaattctagttgatatcaacaacttctccgatgaggtctctcaa
gatcttacacaattccgtggatactatgatgatgcgtggagaaccatgatggtcaatgaa
ggaatgaagggtttgactgctcgtatttccagacaggctggatatgctactggcggatca
caacagtgcaactgcggatctcaagctgctggatgcccagctggaccaccaggagccgcc
ggagaagacggaactccaggagagccaggaactgacggagaggatggaggaaacggtatg
cctggagtcgcccagatggctatggatgctaatggaggagcttgcatcaagtgcccagcc
ggagagccaggaccaccaggaccagaaggaccagcgggaccagcaggaccagcaggaaac
gctggagctgatggagaggccggagctgaaggaccagctggagaggctggacctccagga
cccccaggaccagacggaaagcctggagctgctggatctgacggagaagccggagcccct
ggaacaaagaccacaaatgcaccaggagaaccaggaccagccggaccaccaggaccacct
ggaccaaacggagaggcaggagctggaagcggaccagggccagaaggaccagctggacca
ccaggaccaaacggaaaggatggagaggctggagctccaggaaaagatggagatgctgga
gctgatggtgccccaggaactgacgctgcatattgtccatgtccaccaagatccgctgct
cttggagccggtggtggcgctgagccagccggagccgccccagaagctgctgccgctgcc
ccagaagccgcaccagaagccgcaccagccgctgaaggagccggaggaggagctgagcca
gcaggagccgccgcgcccgatgctgctgctgctgccccagaagccgccccagctgaagca
gcaccagccgctgaaggagccggaggaggagctgagccagcaggagccgcgcccgatgct
gctgctgctgccccagaagccgccccagctgaagcagcaccagccgccgaaggagccgga
ggaggagccgagccagctggagccgctgctccagatgccgccgccgccgcaccagaagct
gctgccgccccagaagccgcaccagctgccgaaggagccggaggaggagcagagccagcc
ggagctgccccagaagccgccgccgcagccccagaaggagccggaggaggtgaagcccca
ccaaccaacggaaagggaggagaagcttccccagcctacccaaccggacagagcagctac
taa

DBGET integrated database retrieval system