KEGG   Caenorhabditis elegans (nematode): CELE_C24A8.1Help
Entry
CELE_C24A8.1      CDS       T00019                                 

Gene name
dop-6
Definition
(RefSeq) DOPamine receptor
Organism
cel  Caenorhabditis elegans (nematode)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 7tm_1
Motif
Other DBs
NCBI-GeneID: 180706
NCBI-ProteinID: NP_508739
WormBase: WBGene00016037
Ensembl: WBGene00016037
UniProt: P91096
Position
X:join(4320863..4320943,4321093..4321158,4321209..4321664,4321721..4321799,4321856..4321968,4322923..4322988,4323057..4323166,4323228..4323399,4324989..4325129,4325530..4325626,4325676..4325872,4326165..4326262,4326309..4326380,4326730..4326834,4327087..4327176,4327226..4327331)
Genome map
AA seq 682 aa AA seqDB search
MNESEIAAAVAAMELEDELLQPEWAYLVSLAMADLIVGAFVMPFSIYLSVNRLHWHLPLF
VCYFYCVLDVAASTSSIIHLVLISIDRYVKKKCVPNIVESCRLVAATKPAEYKTVKHRKR
VYLAIAITWIFSIALSLPLGTGFNTRTSYFLVIEHHCGIYNPIYMLGSSIFAFYLPCLIM
IFTYGYIFYTLRKRLRAIQLQEMAGGQFLGFGADVSNITTSAIQSVIGIAPKNRNMITWE
KPLLKKIEETAAEHASSLNDSEREQLQTILEAVHPSSSGSQENTTIEEDPDRPPSVLLEA
VTLKCEIDTSGPILELPRPTYTKNMSRRFSDAVNSISSRGRMKSVSFGTSRKRRHSHQPQ
GNREVVTSEESKKLHSLKPPLVEKRKMRRLSEMISDWERPSRSSISNMYLYARRESVYIA
RKKLAGLKDWALDLLAKLKSKQGMAIRRETRATKLVATVMVVFLVCWLPFFTLNMIKIYK
LIFNVWSADLEIWFHWFTALGYLNSSLNFFIYSTINPVSIFISNLIKFRHSFRRLLGFRR
SSRRQREKSWMLPPRDSSRGPAKCGCGFHKIVKSPLRKTSSAGPMNNRKISMQKPEIVID
EISPNRISISAGGNTTFRRSSDDCIRRSSSEIIGGITLPSQSSNDKRRGSGMSNSSASLH
IHETRMTFEAMVNDQADCEIFV
NT seq 2049 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaatcggaaatcgcggccgcggtggcggcgatggagttggaggacgaactgctc
cagcctgaatgggcatatctggtttccttagcaatggctgatttaatagttggcgcattt
gtaatgcctttcagtatatatttatcagtaaaccgtcttcactggcacttgccactattt
gtctgttatttctattgcgtcttggatgttgcagcaagcacttcgtctattattcatctc
gtcttgataagtattgacaggtatgtcaaaaaaaagtgtgtacccaacatagtagaaagt
tgcagattggtcgctgccacaaagcctgcagagtacaaaacagtaaaacataggaagagg
gtttacttggcaattgctattacatggatattcagtatagctttgtctcttccattagga
acaggattcaacactcgaaccagctattttctggttatagagcatcactgtggaatctac
aatccaatttatatgttaggaagtagcatttttgcattctacctgccatgtctcataatg
atatttacatacggttatatattttatacacttagaaaacgtttacgtgctattcaactt
caggaaatggctggaggtcaatttcttggattcggagcagatgtctccaacattaccacg
tcagcaattcagtcggtcattggcattgcacccaagaatagaaacatgatcacttgggaa
aagcctcttctcaaaaaaattgaagagactgcagcagaacacgcgagttcattgaacgac
agtgaacgagagcagctgcaaaccatccttgaagcagttcatccatcctcttcaggaagt
caggaaaacacgacgatcgaggaagaccctgaccgacctccttctgttctgctagaggcg
gtcactttaaaatgcgagatcgacaccagcggacccattcttgaactgccacgccctacg
tacacaaaaaacatgtcgcggcgattctccgatgcggtcaattcaatttcgagtcgcggt
agaatgaagtcggtgtcttttggaacttcacgaaaacggcgacattcacatcagccacag
ggaaatcgggaagtcgtgacgtccgaagagtccaagaaattgcactctttgaagccgcca
ctggttgaaaagcgaaagatgagacgtttatccgagatgatatctgattgggaacgaccg
tcaagaagttcgatcagtaacatgtatctttatgcgagaagagaaagcgtctacattgca
aggaagaagttggccggtctgaaagactgggcgctggacctgttagcaaaactgaaatcc
aagcagggaatggcgattcgtcgagagactcgtgcaaccaagttggttgcaactgtaatg
gtggtttttctcgtctgctggcttccgtttttcacattgaacatgatcaaaatttacaaa
ttgatattcaacgtttggtcagcggacctcgaaatttggttccattggtttaccgcactg
gggtatttgaattcgtcactcaactttttcatttactcaacaatcaatccagtaagcatt
tttatatcaaatttgataaaattccgtcattcattccgccgcttacttggcttccgtcga
tcttctcgacgtcagagagaaaaatcgtggatgttaccgccacgagatagcagcagaggt
cctgcaaaatgtggatgcggtttccataaaatcgtgaaaagccctctgcgcaaaacgagc
tcagctggaccaatgaacaacagaaaaatttccatgcaaaaaccagaaatcgtcattgac
gaaatttcaccgaatcgaatttcaatctccgccggaggaaacacaacttttaggcgatct
tcggatgattgtattcgtagatcatcttctgaaataatcggcggtatcactcttccatct
caaagtagtaatgataaacgaagaggatccggtatgtcaaatagttcagcatctctccat
atccatgaaacgcgaatgacgttcgaagcaatggtcaacgatcaggctgattgcgaaatt
tttgtttaa

DBGET integrated database retrieval system