KEGG   Caenorhabditis elegans (nematode): CELE_C25A1.3Help
Entry
CELE_C25A1.3      CDS       T00019                                 

Gene name
tag-72
Definition
(RefSeq) mRNA cap guanine-N7 methyltransferase
  KO
K00565  mRNA (guanine-N7-)-methyltransferase [EC:2.1.1.56]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel03015  mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:cel00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    CELE_C25A1.3 (tag-72)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:cel03019]
    CELE_C25A1.3 (tag-72)
Enzymes [BR:cel01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.56  mRNA (guanine-N7)-methyltransferase
     CELE_C25A1.3 (tag-72)
Messenger RNA biogenesis [BR:cel03019]
 Eukaryotic type
  mRNA processing factors
   5' end processing
    Capping factors
     CELE_C25A1.3 (tag-72)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pox_MCEL Methyltransf_25 Methyltransf_11 Methyltransf_31 Methyltransf_12 Methyltransf_23 NodS
Motif
Other DBs
NCBI-GeneID: 182875
NCBI-ProteinID: NP_492674
WormBase: WBGene00006447
Ensembl: WBGene00006447
UniProt: Q9XVS1
Position
I:complement(join(10160099..10160522,10160856..10161035,10161119..10161297,10161365..10161474,10161522..10161647,10161753..10161876))
Genome map
AA seq 380 aa AA seqDB search
MSSSEVASHYNKVLQVGIEGRKESRIFFMRNMNNWVKSQLINDAKQRVNDNGVNNPRVLD
LACGKGGDLKKWDIAGAKDVVMADVADVSIQQAEERYKQMFGYKKNNIFTVQFIVADCTK
ENLEDRIENKDPFDLVSCQFALHYSFVDEASARIFLKNAVGMLKPGGVFIGTLPDADRIV
WSMRNGENGQFANEVCKITYENVEELAEGKVPLFGAKFHFSLDEQVNCPEFLAYFPLVKH
LLEELDMELLFVHNFAEAINKWLEPGRRLLESMTGLETYPNEKLSGKSDDEYLEAKAKLD
AFPEDERIKTMGTLSKSEWEAICMYLVFGFRKKKSEAEKTEEEPATTKPVAESESEQKEV
TESEEKEDQEDCEHQEAQTN
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgagctcatcagaagtggccagtcactacaacaaagttctacaggttggcatcgaaggc
aggaaagaaagtcgtattttctttatgagaaatatgaataactgggtgaagagccaactt
atcaatgatgcgaaacagcgtgttaacgataacggcgttaataatccaagagtcttagat
ttagcatgtggaaaaggaggagatctcaaaaaatgggacatagctggagcaaaagatgtt
gtaatggcagatgtcgccgatgtttctatccaacaagcagaagaacgatataaacaaatg
ttcggatataaaaagaacaacattttcactgttcaattcattgtcgctgattgcacaaaa
gagaatctggaggatcgtattgaaaacaaagatccatttgatttggtcagctgtcagttc
gccttgcattactcgtttgtagatgaagcttctgccagaatatttctaaaaaacgccgta
ggaatgttgaaacccggaggagtttttatcggaacacttccagatgctgatagaattgtt
tggtcgatgcgtaacggagaaaatggtcaatttgcaaacgaggtgtgtaaaatcacatat
gaaaacgtggaagagttggctgaaggaaaagttccactattcggagccaagttccatttt
tcactcgatgagcaagtcaactgtcctgagtttctggcatattttccacttgtcaaacac
ctgctcgaagagcttgacatggagcttcttttcgtgcataatttcgctgaagcaatcaac
aaatggttggaaccaggacgccgacttctcgaatcaatgacaggtcttgaaacgtatcca
aatgagaagctcagtggaaaatccgacgacgagtacctggaggcaaaagctaaactcgac
gcatttccagaagatgagagaatcaagacgatgggaacactttcaaaatctgaatgggaa
gctatctgtatgtatttggtgtttggtttccgaaagaagaagtctgaagctgagaaaaca
gaagaagaaccagctaccacgaagccagttgctgaatcagaatcagagcagaaagaagtt
actgaaagcgaagagaaagaagatcaggaagattgtgagcatcaagaagctcagacaaat
tag

DBGET integrated database retrieval system