KEGG   Caenorhabditis elegans (nematode): CELE_C25A1.4
Entry
CELE_C25A1.4      CDS       T00019                                 

Gene name
sup-46
Definition
(RefSeq) SUPpressor
Organism
cel  Caenorhabditis elegans (nematode)
SSDB
Motif
Pfam: RRM_1 RRM_5
Other DBs
NCBI-GeneID: 172881
NCBI-ProteinID: NP_492677
WormBase: WBGene00045383
Ensembl: WBGene00007706
UniProt: Q9XVS2
Position
I:complement(join(10169874..10170065,10170119..10170367,10170735..10170974,10171023..10171124,10171840..10172055,10172123..10172409,10172489..10172567))
AA seq 454 aa
MNRNRRDGPQRDVKRERRSRSRSPRRSRIGAAVGSNNGNSSSNNRMVFITNIAYEARWVD
LKSLVREKGGEVAFCELLEDRNGKPKGNAVVEFETREGAEKCVENLQKFDWKGRTIIAKE
IRDPNAFFRTIKTETGIDYLSRTGGGGAGGRGPPPKDLDRPTRTGTYDLFGLNMEFLRQH
NIEPPLCERIFIANLAFNVGTDKLYEVFGMAGKITWMDFRIDKEGKSKGVCVIQYTHPIE
AVQAVSMLNGQRLFDRNLVVKMDRFDKELEHKEGGLPRGLESIGMGLGAEGAPLSNVHGM
FPGDASVPFTAPAAPFVGGPQVVSAGGFGGVVEQANFARSVMNNGPFGGNAGVGGAGGAT
FAQPDVFGVNGAGGLAGAATPQATRVIIIRNLPSDYTWQIVRDRVRNFGEVDSVDMMAPG
AARIRFATFQDAERARAALYGSTVEGRMISVDYA
NT seq 1365 nt   +upstreamnt  +downstreamnt
atgaacagaaatcgtcgagacggaccacagcgtgatgttaagcgagagcgtcggagccga
tccagaagtccaagaagaagtcgtatcggcgctgctgttggaagtaacaatgggaactca
tcatcgaacaaccgaatggtttttatcaccaatatcgcctatgaggctcgttgggtcgat
ttgaaaagtctagttcgcgagaaaggaggtgaagtcgctttctgcgagttgctcgaagac
cgtaacggcaagccaaagggtaacgctgtggttgagttcgaaactcgtgagggtgccgaa
aaatgcgttgagaatctacaaaagttcgactggaagggaagaaccatcatcgccaaagaa
attcgggatccgaatgctttcttccgaaccatcaaaactgaaacaggcattgattacttg
tctcgtaccggaggtggtggtgcaggaggacgaggtcctccaccaaaagatcttgatcgc
cctactcgaactggaacttatgatttattcggtctcaatatggaattccttcgccaacac
aacattgaaccgccactctgtgagcgcatcttcatcgccaatttggctttcaatgtcgga
accgataagctttacgaagtcttcggtatggccggtaaaatcacctggatggacttccgc
attgataaagaaggaaagtcaaagggagtatgcgtaattcaatacactcacccaattgaa
gccgtacaagccgtttcgatgctcaatggtcagcgactttttgatcgaaatctggttgtg
aaaatggatagattcgataaggaactggagcacaaagaaggtggacttccacgaggtctt
gagtcaatcggaatgggtcttggagcagaaggagcaccactttccaatgttcatggaatg
ttcccaggagatgcttcagtgccgttcacagctccagctgccccattcgtaggtggacca
caagttgtttcggctggtggttttggaggagtcgttgaacaagccaactttgcccgatcc
gtcatgaacaatggaccatttggaggaaatgctggtgttggtggtgctggtggagccaca
tttgctcaacctgacgtctttggtgtcaatggagctggtggactcgccggtgctgcgaca
ccccaggcaacaagggttattatcattcgcaaccttccaagcgattatacctggcaaatt
gtccgtgaccgtgttcgaaacttcggagaagtcgactctgttgatatgatggcgccagga
gctgctcgcattcgttttgcaactttccaagacgctgaacgtgctcgtgctgccctctat
ggatccactgtcgaaggccgcatgatcagcgttgactacgcctaa

DBGET integrated database retrieval system