KEGG   Caenorhabditis elegans (nematode): CELE_C27D6.10Help
Entry
CELE_C27D6.10     CDS       T00019                                 

Gene name
srb-1
Definition
(RefSeq) Serpentine receptor class beta-1
Organism
cel  Caenorhabditis elegans (nematode)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 7TM_GPCR_Srb 7TM_GPCR_Srab 7TM_GPCR_Sra
Motif
Other DBs
NCBI-GeneID: 191783
NCBI-ProteinID: NP_494965
WormBase: WBGene00005066
Ensembl: WBGene00005066
UniProt: Q95ZY0
Position
II:complement(join(5169831..5170212,5170255..5170451,5170500..5170718,5170805..5171032))
Genome map
AA seq 341 aa AA seqDB search
MNIENKCDLAFEVTYHPLYRAAQFWTFIFSTLAVPALFIFLLKQIFPLPFHGNIKFMLIS
YFLSAFLFAVVLALTFGYHILVPLFITSKCDLIIQPYLFKVGQLSLTLFITLQMIMPFGF
SIERIIALRMAKSYENVRTVLGPLLIFVLIGIDLILLFTVFRDESFNDSFISFILIPATT
AQTFNSYCWILLYAELGNLLCNCIILLVHSKFKTKFLHQQRSLSVRYELEEISQTSKFTL
IVSFTHILFIGWYLGVTIFIRTVGETFFGSYINYTVARGVYISVPTYNLTIVFVGIKALS
FMNLKRQNNVQSKVQIKSTGSEGARNYENAIASYWNSVSKA
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaatatcgaaaacaaatgtgatttggccttcgaagtcacctatcatccattatatcgg
gctgctcaattctggacttttattttttcaactctagcagttcctgcactttttattttt
ctattgaagcaaatttttccacttccatttcatgggaatataaaatttatgttaatttct
tattttttgtccgcttttttgttcgcagttgttctggctctaacgtttggctatcacata
ctggttccactattcatcacctcaaaatgtgatttaataattcagccatatttatttaaa
gttggtcaattatccttaactttgtttattactcttcaaatgataatgccgtttggattt
tcaattgaaagaataattgcgttacgcatggctaaaagttatgaaaatgttcgtacagta
ttaggaccacttttgatttttgtattgattggaattgatctgatattactttttacggtt
tttcgagacgaaagttttaatgatagtttcatttcatttattctcattcctgcaactact
gcacagacgtttaatagttattgctggattcttctatatgcggaacttggaaatttactt
tgtaattgcataattcttctggttcacagcaaattcaaaacaaaatttctccatcaacaa
cgatctttgtctgtacgatatgaactagaagaaatatcccaaacttcaaaattcacgctt
attgttagtttcacacatattctatttattggatggtatcttggtgtaacaattttcata
agaactgttggggaaacattttttggtagttatatcaactacacagtggccagaggtgtt
tacatcagtgtaccaacatataatctaactatagtttttgttggaatcaaggcattaagt
tttatgaatctgaaaaggcaaaataatgttcaaagtaaagttcaaatcaaatcgacagga
tcagaaggagctcgaaattatgaaaatgcaatcgcaagttattggaattctgtgtcgaaa
gcttag

DBGET integrated database retrieval system