KEGG   Caenorhabditis elegans (nematode): CELE_C28C12.5
Entry
CELE_C28C12.5     CDS       T00019                                 

Gene name
spp-8
Definition
(RefSeq) SaPosin-like Protein family
Organism
cel  Caenorhabditis elegans (nematode)
SSDB
Motif
Pfam: SapB_2
Other DBs
NCBI-GeneID: 177652
NCBI-ProteinID: NP_501447
WormBase: WBGene00004993
Ensembl: WBGene00004993
UniProt: Q18279
Position
IV:join(8481666..8481752,8481810..8481968,8482012..8482137,8482187..8482267,8482316..8482636,8482744..8482921,8482968..8483131,8483363..8483446,8483526..8483534)
AA seq 402 aa
MKSIFVFAVLAALALGAQSAPSPCESCKSMVQNFIDASKDRMKMAQLKVSLSMLCVGTSH
QSDCSKTLDKLDFIAYKLAPYLADTSAVCSKLQMCGESQFSPLARLAMLYLKKSEAIVAN
DNIMRQEVCDECQASTAQIGKLVGDEFTTYAVKSTLQRFVCKSAGKAHKACNIFVSSVIP
DLMTEMKDMFTEKELMCSNMGLCSATSKPAAREAPKQPASEMWKSMGMVKTSNGEELMSC
FECTLSADALLQEFIDKRQGTADDIQTVACNKMVANWTDGCNDFVHMYMSTVLFLTYNQF
DGRGICTMMHSCEKKENALVEMAMSEKVMLGCENCKAVEHFFAQNQEALHSHAVDGLYSN
VCQKLPTALGTMCEASIIRLSRKFFARTADLAASGAMCSQMC
NT seq 1209 nt   +upstreamnt  +downstreamnt
atgaaatccatttttgtcttcgccgtgctggcagctttggctcttggagcacaatctgct
ccatctccatgtgaatcatgcaaatcgatggttcaaaacttcattgatgcttctaaggat
cgcatgaagatggctcaactgaaggtttctctttcaatgctctgcgtaggtacatctcat
caatctgactgctcaaagactcttgacaaacttgacttcatcgcctacaaacttgctcca
tacttggctgacacctccgctgtatgctcaaagctccaaatgtgcggtgaatctcaattc
tcaccacttgctcgtcttgccatgctttacttgaagaaatcagaggccatcgtagctaat
gataacattatgagacaagaagtttgtgacgaatgtcaggcatcaactgcacagatcgga
aaactcgttggggatgaatttactacctatgcagtcaaatctacccttcaacgctttgtc
tgcaagagcgccggaaaagcccacaaggcatgcaacatctttgtctcctccgtcattcca
gatcttatgaccgagatgaaggatatgttcaccgaaaaggaacttatgtgctcaaacatg
ggactctgctctgctacatccaagccagctgctcgtgaagctccgaaacaaccagcatct
gagatgtggaagtctatgggaatggtgaagacaagcaacggagaggagcttatgtcttgc
ttcgagtgcacactttccgctgatgctcttcttcaggaattcattgataagagacaagga
acagctgatgacatccaaacagttgcctgcaataagatggttgccaactggacagatgga
tgcaatgactttgttcatatgtatatgtcaactgtgcttttcttgacttacaatcaattt
gatggaagaggaatctgcacaatgatgcattcatgcgaaaagaaggaaaatgctctcgta
gaaatggccatgtcagagaaggttatgttgggatgtgaaaactgtaaagctgtcgagcac
ttctttgctcaaaaccaagaggctcttcactctcacgctgttgacggactctactcgaac
gtctgtcaaaagcttccaactgctcttggaactatgtgtgaagcctcaatcatccgcctg
tctcgcaagttcttcgcccgtaccgccgacctcgccgcaagcggagcaatgtgctcgcag
atgtgctag

DBGET integrated database retrieval system