KEGG   Caenorhabditis elegans (nematode): CELE_C28C12.7
Entry
CELE_C28C12.7     CDS       T00019                                 

Gene name
spp-10
Definition
(RefSeq) SaPosin-like Protein family
  KO
K12382  saposin
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel00600  Sphingolipid metabolism
cel04142  Lysosome
Brite
KEGG Orthology (KO) [BR:cel00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    CELE_C28C12.7 (spp-10)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    CELE_C28C12.7 (spp-10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cel04147]
    CELE_C28C12.7 (spp-10)
Exosome [BR:cel04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CELE_C28C12.7 (spp-10)
SSDB
Motif
Pfam: SapB_2 SapB_1 PA28_alpha YokU pRN1_helical
Other DBs
NCBI-GeneID: 177651
NCBI-ProteinID: NP_741465
WormBase: WBGene00004995
Ensembl: WBGene00004995
UniProt: Q18276
Position
IV:join(8477183..8477470,8477524..8477637,8477684..8477821,8477870..8477944,8478027..8478089,8478319..8478408,8479779..8479850,8479979..8480156,8480205..8480380,8480435..8480518,8480565..8480576)
AA seq 429 aa
MKYFILTLAVLGSTLAYSKQNMLDTNRVQAEVIENSSCEECENVIKRISEAAKDPKKIEE
LKIVLGMMCRETSYADECRLFVSQLDKFIDKLQPFLKNPHAVCTRLHICSNKKIDSFRRI
LLEFAKRAQKTFDAPAIVCDECQFVVKELKTVVEDKKSQAEARDFLRENVCKSLGQYRGF
CDLVVDEYLPQFIQELDAILQDPHQVCVDIKACNSASAQGLKARKYVEASNEEKEKVENE
VDAFWNGAAMKNNKGQTLAMSCFECKFVVEDMQTDMITNRKKLSDDVRDFACYKIVTANM
TDSCIDFLDLYLPTVIQMTVEQATPQGVCLANKCCPASSVAPLRDFTFQEIQAEKCPKMM
ELETYLSSNLVGSAMEKFFENSLTETFCSGLLSFFQPSCQQIMSSVAPRFVSLTAVLASQ
NKFSQAMNC
NT seq 1290 nt   +upstreamnt  +downstreamnt
atgaagtatttcatcctgacacttgccgttctcggctcaactcttgcatattcaaagcag
aatatgcttgacacaaaccgtgttcaggctgaagtaattgagaactcatcttgtgaagaa
tgtgagaatgttatcaaaagaatttctgaagctgctaaggatccaaagaaaattgaagaa
ttgaagattgttctcggaatgatgtgcagagagacttcttatgctgatgaatgtcgtctt
ttcgtttcacaattggacaagttcattgacaaacttcagccattcttgaagaatccacac
gcagtctgcactcgtcttcatatctgctcaaacaagaaaatcgactcattccgccgcatt
ttgctcgagttcgccaagcgcgctcaaaaaacttttgacgctccagccatcgtctgtgac
gaatgccaatttgtcgtcaaggagttgaagactgttgttgaggacaagaagagccaagct
gaagcccgtgacttccttcgtgagaacgtgtgcaagagcctcggacagtacagaggattc
tgcgatttggtcgttgacgagtatcttccacaattcatccaagagcttgacgccattctc
caagatccacaccaggtgtgcgttgacatcaaggcctgcaactctgcttctgctcaagga
ctcaaggctcgcaaatatgtagaagcttccaatgaagaaaaggaaaaggttgagaatgag
gtcgatgcattctggaatggagccgcaatgaaaaacaacaagggtcagactctcgccatg
tcctgtttcgaatgcaagtttgttgttgaagacatgcaaacagacatgatcactaacaga
aagaaactttccgatgatgtccgtgatttcgcatgctacaagattgtcacagccaacatg
actgattcatgtattgatttcttggatttatatctcccaactgttattcagatgacagtt
gaacaggcaactccacaaggagtttgtctagctaacaagtgttgtccagcaagttcagtt
gccccacttcgtgatttcacattccaagagattcaagctgaaaaatgtccgaaaatgatg
gaattggaaacatatttgagctcaaaccttgttggaagtgccatggagaaattcttcgaa
aactcactgactgagactttctgctctggattattatcattcttccaaccaagttgtcaa
caaatcatgtcatctgttgctccaagatttgtcagtttgaccgcagtccttgcaagccaa
aacaaattcagtcaggctatgaactgctag

DBGET integrated database retrieval system