KEGG   Caenorhabditis elegans (nematode): CELE_C30A5.5
Entry
CELE_C30A5.5      CDS       T00019                                 

Gene name
snb-5
Definition
(RefSeq) Synaptobrevin-like protein 5
  KO
K08514  vesicle-associated membrane protein 5
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel04130  SNARE interactions in vesicular transport
Brite
KEGG Orthology (KO) [BR:cel00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    CELE_C30A5.5 (snb-5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cel04131]
    CELE_C30A5.5 (snb-5)
Membrane trafficking [BR:cel04131]
 SNARE
  VAMP, Ykt6, Sec22 (R)
   VAMP
    CELE_C30A5.5 (snb-5)
SSDB
Motif
Pfam: Synaptobrevin Spc7 COG2 DUF533
Other DBs
NCBI-GeneID: 191767
NCBI-ProteinID: NP_498790
WormBase: WBGene00004899
Ensembl: WBGene00004899
UniProt: P34351
Position
III:join(8203091..8203171,8203218..8203296,8204919..8204965,8205013..8205114)
AA seq 102 aa
MNHQPPPVSRIGWDDQKIMRTRRELDSVKAIMKENVQKIMERQGKLDDLVERAQRLEEAS
DVYVKCAVKIKREMSWKANSLRYGIIAVSSVSAFAGLAYSFL
NT seq 309 nt   +upstreamnt  +downstreamnt
atgaatcatcaaccaccaccagtgagccgtatcggttgggacgatcaaaagattatgaga
acaagaagagaactggattcggtgaaggccattatgaaggagaatgtgcaaaaaatcatg
gagagacagggaaaacttgatgatcttgttgaaagagctcagaggctcgaggaggcatcg
gatgtgtacgtcaaatgcgccgtcaagataaaacgagagatgagctggaaggccaattct
cttcgctacgggatcattgctgtgtcaagtgtctccgcatttgcaggacttgcctattcg
ttcctataa

DBGET integrated database retrieval system