KEGG   Caenorhabditis elegans (nematode): CELE_C30F8.2
Entry
CELE_C30F8.2      CDS       T00019                                 

Symbol
vha-16
Name
(RefSeq) V-type proton ATPase subunit
  KO
K02146  V-type H+-transporting ATPase subunit d
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel00190  Oxidative phosphorylation
cel01100  Metabolic pathways
cel04142  Lysosome
cel04145  Phagosome
Module
cel_M00160  V-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:cel00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    CELE_C30F8.2 (vha-16)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    CELE_C30F8.2 (vha-16)
   04142 Lysosome
    CELE_C30F8.2 (vha-16)
SSDB
Motif
Pfam: vATP-synt_AC39
Other DBs
NCBI-GeneID: 172134
NCBI-ProteinID: NP_491515
WormBase: WBGene00016258
Ensembl: WBGene00016258
UniProt: Q95YD5
Position
I:complement(join(5080310..5080399,5080775..5080846,5080898..5081152,5081205..5081362,5081624..5081802,5081847..5082018,5082137..5082257))
AA seq 348 aa
MGEFLFNIDHGYLEALTRGLKGGLLAQADYANLVQCETLEDLKLHIQSTDYGNFLANEPG
AITVQVIDEKLKEKLVTEFTHLRNNALEPLATFLDYITYSYMIDNIILLITGTLHQRPIS
ELINKCHPLGSFEQMEAIHIASTPAELYNAVLVDTPLANYFVDCINEQDLDEMNVEVIRN
TLYKAYIEDFYKFCAGLGGKTAEVMCDILAFEADRRSIIITINSFDTELSKDDRQKLYPR
CGKLFPDGLTGLSRADDYDQVKQVCEFYSDYKPLFEGSGNGPGEKTLEDKFFEHEVKLNV
HSYLHQFHFGVFYAFIKLKEQEMRNIIWIAECISQRHRTKIDNYIPIM
NT seq 1047 nt   +upstreamnt  +downstreamnt
atgggagagttcttgttcaatattgatcacggatatttggaggcgctgactcgcggactt
aaaggaggtcttcttgctcaagctgactatgccaatttggttcaatgtgagactttggaa
gatttgaagcttcacatccaatcgactgactacggaaatttcttggccaacgagcctgga
gcaattaccgttcaagttatcgacgagaagcttaaggagaagcttgtcacagagttcact
catcttcggaataatgcattggagcccttggcaacattcttggactacattacatactcg
tacatgatcgacaacattatcctgttgatcaccggaactcttcaccagagaccaattagc
gagttgatcaataaatgccatccacttggatcattcgagcagatggaggctattcatatt
gcttctactccagctgagctctacaatgccgttcttgtcgatacaccactcgctaactac
tttgtcgactgcatcaacgagcaagatttggacgagatgaatgttgaggttatccgtaat
actctctacaaggcttacatcgaggacttttacaagttctgtgcaggactcggaggaaag
accgctgaagtcatgtgcgacattcttgctttcgaagctgatcgtcgttcgatcatcatc
accatcaactcattcgacaccgagttgagcaaggatgatcgtcaaaagttgtatccacgt
tgcggaaaactattcccagatggtttgactggactctctcgtgctgatgattatgatcaa
gtgaaacaagtttgcgaattctactctgattataagccacttttcgaaggatctggaaat
ggaccaggagagaagactttggaggataaattctttgagcacgaggttaaattgaatgtc
cactcttatcttcatcaattccactttggagtcttctacgcattcatcaaactgaaggag
caagaaatgcgtaatatcatctggatcgccgaatgcatctcgcaacgacaccgcaccaag
attgacaactacatcccaattatgtaa

DBGET integrated database retrieval system