KEGG   Caenorhabditis elegans (nematode): CELE_C33B4.3Help
Entry
CELE_C33B4.3      CDS       T00019                                 

Gene name
shn-1
Definition
(RefSeq) Protein shank
  KO
K15009  SH3 and multiple ankyrin repeat domains protein
Organism
cel  Caenorhabditis elegans (nematode)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ank_2 SAM_1 Ank_5 Ank_4 Ank_3 Ank SAM_2 PDZ_6 PDZ FERM_f0 PDZ_2
Motif
Other DBs
NCBI-GeneID: 174739
NCBI-ProteinID: NP_001022006
WormBase: WBGene00006444
Ensembl: WBGene00006444
UniProt: B7WN72
Position
II:complement(join(11384925..11385154,11385778..11385931,11386069..11386216,11386701..11387542,11387780..11388102,11388610..11388882,11388940..11389281,11389328..11389916,11389987..11390088,11390348..11390617,11390725..11390784))
Genome map
AA seq 1110 aa AA seqDB search
MNQEEDTVNLQIFVPELNVRKFLAVTQNDFIWDVKRKLLATLPQALPQAFNYGLFLPPCD
GRAGKFLLEDRTIRDYPFTDCVPYLELKYKKRVYKMLNLDEKQLKAMHTKGQLKKFMDYV
QQKNNEKVEKMCSQGLDANFHDAQGETPLTLAAGIPNNRAVIVSLIGGGAHVDFRNSEGQ
TAMHKAAFLSSFENVKTLIELGASPNYRDPIGLTPLYYNMLTADSNDQVAEILLREAADI
GVTDMHGNHEIHQACKNGLTKHVEHLLYFGGQIDAENVNGNSPLHVCAVNNRPECARVLL
FRGADHLAVNKQGQTALHVSHIVGNPGVADVVQAHNPKSSVPYRGTPQYSTRRRLSSTIT
RRRSMSQSSICSQDVYRTPQSVRKGPMSAAPSPSPSRSSRTTITPSEYGTMRRSGMDSMR
GGGMIAAGHETNIARILVIPRGVKGFGFILRGAKHVAMPLNFEPTAQVPALQFFEGVDMS
GMAVRAGLRPGDYLLEIDGIDVRRCSHDEVVEFIQQAGDTITLKVITVDVADMSRGGTIV
HRPPTDTHDAHGVDYYAPNEIRNAYSESRHASVRQRPGSGRRISAAELENLMVRQRVPSV
QGSPYQMQYDQESLNGGYSSKKYNSVSDMKRRKGQRNVVASSAGLNRSTFEQAAPTTSTF
EYNCSSRSTPQLSRMDSFDSFDDEDEMPAPPPASYISPDLQRDSSMQRSEYSRPFRPTSR
PKTPPPPPPMQHQNHQNHQYQQQHPSLPRSASTPQPIQQQQSSIPPPPPPPPPPHCEPTM
VHVEFTPPSTSSVPPPPPPLPPISSGAPPPPPPPPPGGLMHVAASAPVLMSNSKGISADA
LKSVQLKKAEPRETSAASVSNNNNNNNNSTTDFQMDLKNALAKRRSKVAHDVDEDEERES
RFEGLSLRETVRENVVERGKGIQNIGIVNKKDSGYTSSRTSLEPSESEEKDHRPHFSLDH
SPNVQRVTLISQHLEDNYGQKDNMSVASSSTASSSSTVDLTKPGCFVVPSHVIPPVDYDD
DPDSGTGDSDGEIRCSEISFEHKKVDVWSVDDVIGWLSSLHLSEYTPAFRSQRINGRCLR
QCDRSRFTQLGVTRIAHRQIIESALRGLLQ
NT seq 3333 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaagaggaggacaccgttaatttgcagatcttcgttccggagcttaacgttcgg
aagttccttgcggtgacccaaaacgatttcatctgggatgtgaaacgcaagttattggcc
acccttccgcaagctcttccgcaagctttcaactacgggctcttccttcctccatgcgat
ggacgagccggaaagtttcttctcgaggatcggaccattcgtgactatccgttcactgat
tgtgttccgtatctcgagttgaagtataagaaacgagtctataagatgctcaatcttgac
gagaagcagctgaaggcaatgcacacgaagggccaactcaaaaagtttatggactacgtt
cagcagaagaataacgagaaagtggaaaagatgtgttcgcagggacttgatgcaaatttt
catgatgctcagggagaaaccccattaacgctggctgctggaatcccgaacaatcgagct
gtaattgtatcccttattggtggcggagcacacgtggattttcgcaattcagaaggccaa
actgcaatgcacaaagccgcatttctatcttccttcgagaatgtaaaaaccttgatcgaa
cttggagcaagcccaaactatcgtgatccaattggacttacaccgctctactataatatg
ttgacagcagattcgaatgatcaagtcgctgagattcttctacgagaagccgccgacatc
ggtgtgaccgatatgcacggaaaccacgagattcatcaagcatgcaagaatgggttaacg
aaacatgtggaacacttactctatttcggtggtcagatcgatgctgaaaatgtaaatggg
aatagtcctcttcatgtctgtgcagtgaacaataggccagaatgtgcaagagtactgctg
tttcggggagctgatcatctagctgtgaacaagcaaggacaaactgcgttacatgtttcg
catattgtcggaaatcctggtgtggctgatgtcgttcaagcacataatcctaaatcttca
gtaccatatcgcggcactcctcaatactcaactcgccgacgcctcagctcaaccatcact
cgccgacgttcgatgtcccaatcctcaatatgcagccaggatgtctaccgtactccccaa
agtgtacgaaaaggtccaatgtctgcagctccatcgccaagcccgtctcgatcctcccgt
actaccatcaccccatcagagtacggtacgatgcgacggtctggaatggattcgatgcgt
ggtggtggaatgattgcagctggacacgagacaaatatcgctcggattctggtgattcca
cgtggtgtcaagggattcggtttcattttgagaggagctaaacatgtcgccatgccattg
aacttcgagccaactgctcaagtgccggctcttcaattttttgaaggtgtcgacatgtcc
ggaatggcggttcgcgcgggattaaggccaggagattacttgctggaaattgatggaatc
gatgtgcgaaggtgttcacacgatgaagtcgtcgaattcattcagcaagccggtgacacg
attacactgaaagtgataacagtcgatgtagctgatatgagtaggggaggaactattgtg
catcgaccgccaacagacacgcatgatgcgcatggagttgattactatgccccaaatgaa
atcaggaacgcctactcggaatcacgtcacgcgtcagtcaggcaaaggccgggtagcggg
aggaggatatccgcagcggaattggagaatttgatggttcgacagcgggtaccgtcggtg
caaggttcaccatatcaaatgcaatatgatcaggagtcgttgaatgggggttattcgtca
aagaagtataattcggtttctgacatgaagaggaggaaaggtcaacggaatgtggtggct
tcatctgccggattgaataggtcgactttcgagcaagcggctcccacaactagcacattc
gagtacaactgtagcagtcgaagcacacctcaactatctcgaatggactcatttgattca
tttgacgatgaagatgagatgccagctccaccaccggcgtcgtatatctctccggatttg
cagagagattcttcaatgcagcggagtgaatattctaggccgttccgaccaacgtcaagg
ccgaaaactccaccacctcctccaccgatgcaacatcagaatcatcagaaccaccaatat
caacaacaacatccatctcttccaagatcagcttcaacacctcaaccaattcagcagcag
cagtcatcgattccaccaccgcctccaccacctcctccgccacactgcgagccaacgatg
gtacatgttgagttcacacctccatcaacatcttcagtacctcctccacctcctccattg
cctccaatctcatctggagctccgccaccacctccaccacctcctccgggaggtttgatg
catgtggctgcgagtgctccggttttgatgagcaattcaaaaggaatatcagcagatgcc
ttgaaatcagttcaattaaaaaaagcagaaccacgagaaacatcggcggcttctgtcagt
aataataacaataataacaacaactccacgacagattttcaaatggatttgaagaatgcg
ttggcaaagaggcggagtaaagtagctcacgatgtcgatgaggatgaggagagagaaagt
cgattcgaaggattatcacttcgagaaactgttcgggaaaatgttgtagaacgtggaaaa
ggaattcagaacattggaatagttaataagaaggacagtgggtacacatcttctcgaacg
tcactggaaccatctgaatcggaagaaaaagatcatcgaccccatttctcacttgatcac
tctccaaatgttcaaagagtgacactgatctctcagcatctcgaggataattacggacag
aaggacaatatgtctgttgcctcgtcgtcaactgcgtcatcatcatcaacagttgatcta
acgaaacctggatgcttcgtggtaccatctcatgtcattccacctgtcgattatgatgat
gatccggattctggaacaggcgatagcgatggagagattcgctgtagtgaaatatcattc
gaacacaagaaggtagatgtctggtcggtggatgacgtcatcggttggctctcatcacta
cacctctctgaatatacaccagcatttcgaagtcaacgaatcaatggccgatgccttcgc
cagtgcgatcggtctcgatttacacagctcggtgtcacccgaattgctcatcgccagata
attgaatcagctctccgtggcctcctccagtga

DBGET integrated database retrieval system