KEGG   Caenorhabditis elegans (nematode): CELE_C33G8.5Help
Entry
CELE_C33G8.5      CDS       T00019                                 

Gene name
srab-4
Definition
(RefSeq) Serpentine Receptor, class AB (class A-like)
Organism
cel  Caenorhabditis elegans (nematode)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 7TM_GPCR_Srab 7TM_GPCR_Sra 7TM_GPCR_Srb Sre RIC3
Motif
Other DBs
NCBI-GeneID: 183177
NCBI-ProteinID: NP_504772
WormBase: WBGene00016363
Ensembl: WBGene00016363
UniProt: Q18398
Position
V:join(7004151..7004356,7004895..7005324,7005370..7005630,7005678..7005767)
Genome map
AA seq 328 aa AA seqDB search
MSDCEQMTDMTTSLWLRLSLFVNLGITIISFPVLLTALHYINSQQLFHRNTRIQIKVHIF
ALLVHSTGRFALHSLDLINYFSNTGCDALPDFYRCLVVRGLYNFGMALAAMCSTSLVIER
AIALHYNSTYEMCGRGFGVLLGFLQLFLAFAFLFKLYFDASFTPVPNVTLYYCQTLASGH
GSVWTINAPLYAVMIAQCVCRLAFWYIGVQTKRKRNTQKLQTLSTRYTLEQGIRSIKALN
MFINANCFVFFFFSFIGTSLHFNSSKMSRPTYFALVEVIHFIPTYGILLSIYIYFSLKKL
DSKQKTSLTKSMQMDPSRYLIEFKKQIG
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgtcggactgcgagcagatgacagatatgaccacatctttgtggctccggctatccctt
tttgtgaatctcggcatcacgataatctcgtttccagttctgttaactgctttacactat
ataaattctcagcaactgtttcatcggaatacaaggattcagattaaagttcacatattt
gcattgttggttcattccacaggaagatttgctcttcattccctggacctcataaactat
ttttcaaatactggttgtgatgctctacccgatttctatcgatgtcttgttgttcgagga
ctttataactttggaatggcgcttgcagcaatgtgctcaacaagtcttgtcatcgaacga
gcaatagcacttcactataactcgacttatgaaatgtgtggaagaggattcggtgttctt
ctaggatttcttcaacttttcctcgcatttgcattcttgtttaaactctactttgatgcc
tcatttacaccagtcccaaatgttactctttattattgtcagactctagcttccggtcac
ggatccgtctggacaattaatgctccactatatgcagttatgattgctcagtgtgtatgt
agattggcgttttggtacatcggagtgcaaactaaaaggaagagaaacacccagaaacta
caaacactgagcactcggtatactttggagcaaggaattcgatctataaaagcactgaat
atgttcattaacgccaattgtttcgtatttttctttttctcgtttattggaacttcatta
cattttaattcgagtaaaatgagcagaccaacgtactttgctctcgtggaagtgattcat
tttattccaacttatggaattctactttcaatttacatttatttttctttgaaaaagctt
gactcaaagcaaaagacatcactcacaaaaagcatgcagatggatccgagtcgttatctg
atcgaattcaaaaaacaaattggttaa

DBGET integrated database retrieval system