KEGG   Caenorhabditis elegans (nematode): CELE_C34D1.2Help
Entry
CELE_C34D1.2      CDS       T00019                                 

Gene name
dmd-11
Definition
(RefSeq) DM (Doublesex/MAB-3) Domain family
Organism
cel  Caenorhabditis elegans (nematode)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DM zf-MYST Mfp-3
Motif
Other DBs
NCBI-GeneID: 183203
NCBI-ProteinID: NP_506289
WormBase: WBGene00007930
Ensembl: WBGene00007930
UniProt: Q18435
Position
V:complement(join(13236171..13236338,13236385..13236461,13236505..13236604))
Genome map
AA seq 114 aa AA seqDB search
MVADVLRQSVLVPISMYPQYPVPRRYTTSVFKEYQKKKKIYYCQRCLNHDVPRPRKNHKC
ECPYADCTCEKCGLVEKRRILNIRLQNYNQFNIENENDSKLIIVEDDDKKKQGG
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atggttgctgatgtactccgacagtcagttctcgtgcctatttccatgtatccacagtat
ccagtgcctaggaggtacacaacatctgttttcaaggagtatcaaaagaagaagaagatt
tattattgccaaagatgtttaaaccatgatgttccaaggcctaggaaaaatcacaaatgt
gagtgtccatacgcagattgcacttgtgaaaagtgtggattagtggaaaaacggagaatt
ttgaatattcggcttcaaaattataatcagttcaatattgagaatgagaatgattcaaag
ttgattattgtcgaggacgacgacaagaagaaacaaggaggttag

DBGET integrated database retrieval system