KEGG   Caenorhabditis elegans (nematode): CELE_C34E10.5
Entry
CELE_C34E10.5     CDS       T00019                                 

Gene name
prmt-5
Definition
(RefSeq) Protein arginine N-methyltransferase 5
  KO
K02516  type II protein arginine methyltransferase [EC:2.1.1.320]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel03013  RNA transport
Brite
KEGG Orthology (KO) [BR:cel00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    CELE_C34E10.5 (prmt-5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:cel03041]
    CELE_C34E10.5 (prmt-5)
   03036 Chromosome and associated proteins [BR:cel03036]
    CELE_C34E10.5 (prmt-5)
Enzymes [BR:cel01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.320  type II protein arginine methyltransferase
     CELE_C34E10.5 (prmt-5)
Spliceosome [BR:cel03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    CELE_C34E10.5 (prmt-5)
Chromosome and associated proteins [BR:cel03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    PRMTs (protein arginine metyltransferases)
     CELE_C34E10.5 (prmt-5)
SSDB
Motif
Pfam: PRMT5 PRMT5_TIM PRMT5_C Peptidase_A4
Other DBs
NCBI-GeneID: 175717
NCBI-ProteinID: NP_498112
WormBase: WBGene00016408
Ensembl: WBGene00016408
UniProt: P46580
Structure
PDB: 
3UA4 3UA3

Position
III:join(5230579..5230874,5230924..5231005,5231099..5231292,5231374..5231655,5231700..5232105,5232383..5232864,5233484..5233655,5233880..5234098,5234147..5234218)
AA seq 734 aa
MSNRTYADNLFPQQVAEQHEEQMSSGSSPKSNSPSRSISSVEAANSRIHIGWMATTLDVA
ENLDRHVATFCTRLGEFKYNFVVYPIGGVVRAFWTPNGSAENHPPVIDLPDVQLRNDLWE
SYVVGKISPWIDCDSSDPAFASLSEEHLLKELSYICYLGLQTMAIELTRISSPRTAAILK
KWIWTRNSRFTVWVQLPSAIEKCKDYDAFTIEHVDLWTIWADFRKNCGNFSGVYFQVALT
ISSELPDELTELKLVDRWKAEPLAAFVIESGLFISGRNGEASIPSAHINLLKHLWTTDAL
RIVLRATTDTFKYNTSIKSEYSQALRHAVRNVNYRSRPDVGEGSNDSTHYLNVIEYKDVL
QAPLQPLSENLDSGVYNTFEQDQIKYDVYGEAVVGALKDLGADGRKTVVIYLLGGGRGPI
GTKILKSEREYNNTFRQGQESLKVKLYIVEKNPNAIVTLKYMNVRTWKRRVTIIESDMRS
LPGIAKDRGFEQPDIIVSELLGSFGDNELSPECLDGVTGFLKPTTISIPQKYTSYVKPIM
STHIHQTIKAQSIPYLSRAIPSHGRGEPELDEDEMWIQKYPQGHVRNNMDQIYVVYLSKY
IPLAETTKPVFTFEHPNFMNSSNERSDSIEFVMDRNADLMGFAGYFDLQLYKTVMLSIEP
STHTPGMVSWFPAVIPLRDQLRVGEGDRISLKIDRKVDNTGVWYEWHVEKKKTNGESVST
PIQNPNGESYYMRM
NT seq 2205 nt   +upstreamnt  +downstreamnt
atgagtaacagaacgtatgccgataatctgtttccacaacaggtcgcggagcagcatgag
gaacagatgtcttctggttcttcgcccaaaagtaattctcccagcagaagtataagctct
gttgaggcagcgaactctagaatacacatcggatggatggccacaaccttggacgttgcc
gagaatctagaccgtcatgttgctactttctgtacacgactgggagagttcaagtataac
tttgtcgtctacccgattggaggggtcgttcgcgcattctggacgcctaatggaagcgcg
gagaatcatccacctgttattgatttgcccgatgttcagctgagaaatgatctctgggaa
agctatgttgtaggaaaaatttctccatggatcgactgtgactcttctgatccagccttt
gcctcgctttccgaggaacatcttctgaaagagctcagctacatttgttatttgggtctt
caaacgatggcaatcgagctcacacgcatctcgtcgcctcgtactgctgccattttgaaa
aaatggatttggactagaaattcgcgttttactgtttgggttcaacttccgtctgcaatt
gaaaagtgcaaagattatgacgctttcacaatagaacatgttgatttatggacaatttgg
gccgatttccggaagaattgtggtaatttcagtggtgtttatttccaagtggctttgacg
atctcttcggaacttcccgatgagcttactgagcttaaacttgtggaccgttggaaggcc
gagcccctagcagcttttgttatcgaatcgggtctttttatttctggaagaaatggagaa
gcatcaattccaagtgcccacataaatttattaaaacatctatggacaactgatgcactt
cggatcgttcttcgtgccacaacggatacattcaagtacaatacttctatcaaatccgag
tattctcaagctcttcgtcatgcagttcgaaatgttaattaccgaagtcgtcctgatgtt
ggagaaggatcgaatgactccactcattatcttaatgttatcgaatacaaagatgttttg
caagcacctcttcaaccattgtctgaaaatttggattcaggagtttataatacattcgag
caggatcaaattaaatacgacgtgtatggagaagctgtagttggagcattaaaagatctt
ggagctgacggaagaaaaactgttgtcatttacttgttgggaggaggacgtggtcctatt
ggaacgaaaattctgaaatctgaaagagaatacaacaacacattccgacaaggccaagaa
agtctcaaagtgaagctttatattgttgaaaagaatccaaatgcaatcgtcactctgaaa
tatatgaatgtgagaacatggaaacgacgagtaacgattattgaaagtgatatgcgaagt
ctgccgggaattgcgaaagatcgtggattcgaacaacctgacataattgtttcggaactt
cttggaagttttggagataacgagttgagtcctgaatgtctagatggtgtcactggattt
ttgaagccaacaacaatttcaattccacagaagtacactagctatgtgaagccaataatg
agtactcatattcatcaaacaattaaagctcaaagtattccttatttgagtcgtgcaatt
ccatcgcatggtagaggtgaaccggaattggatgaagacgaaatgtggattcaaaaatac
ccacaaggacatgttcgtaacaatatggatcaaatctacgttgtatatctttcaaaatac
attccacttgccgaaaccaccaaaccagtattcacatttgaacatccaaatttcatgaat
tcaagcaatgagagaagcgattctattgaatttgttatggatagaaatgcagatctgatg
ggattcgccggctactttgatcttcaactctacaaaaccgtgatgctttcaattgaacca
tcaactcatacacctggaatggtcagttggttcccagctgttattccacttagagatcaa
ttgagagttggagaaggtgacagaatttctctgaaaatcgatcgaaaagttgacaatact
ggtgtgtggtacgaatggcatgttgaaaaaaagaaaaccaatggcgaatctgtgagcacc
ccgatccagaatccaaatggagagagctattacatgagaatgtag

DBGET integrated database retrieval system