KEGG   Caenorhabditis elegans (nematode): CELE_C34F6.10Help
Entry
CELE_C34F6.10     CDS       T00019                                 

Gene name
C34F6.10
Definition
(RefSeq) Uncharacterized protein
Organism
cel  Caenorhabditis elegans (nematode)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: fn3 Pur_ac_phosph_N Interfer-bind fn3_2
Motif
Other DBs
NCBI-GeneID: 181313
NCBI-ProteinID: NP_509877
WormBase: WBGene00007944
Ensembl: WBGene00007944
UniProt: G5EF49
Position
X:complement(join(11229807..11229944,11229991..11230062,11230132..11230299,11230355..11230691,11230741..11230818,11230864..11231666,11231717..11231854,11231906..11232053,11232103..11233070,11233189..11233296,11233520..11234311,11234367..11234438,11234508..11234620,11236333..11236712,11237283..11237365))
Genome map
AA seq 1465 aa AA seqDB search
MSQDELSNPAAAANEGIRQEFFRNFLKATGTSGGDMKTLETLDDGGSTSSHQTSPEYPSP
PPPSNSPPESMASLQAESPIEDEDARHEMTSTEGTSSTGTGSPQEPKTWISQPGYHPVPI
SGPLPRHPQSILFVHVNDGEILQLHQQGNNEVVGNLLGPGTVRMIGEPGMTNQPLPIQLR
HNQQCHQFVDEEGNLRHVVLSVASSDNSGQSSQELNVPQLVGSQQLLNAIGGTPTQNGPG
TSSSRGSGRGNHGGGRRNYGNQRSLHTNNNESGQHSQNGHSGHRNVYSRGNYRGNKYNSR
GRMDYHGKARNDNPSYMANNVQELPELAVNTHGSIDSNVQVTASTTQDMVTLRQPTPVMT
LPPPPQQRSLLGEPSGPPMGEMQPIVHGIPSAQSVNFPPPGLPLLIPSVHEIPRQDLSVM
PAMMNGSVQSTMMQDPMMPGTSMGMNPQMFGVPPPPPGMMILSTDAAFNNNKWIPYQTLG
ENERLLKVLSTLRPIRVANTLTTEMEFLYTPLKINDYRFEHGICLFGPIENSDVSYHATV
FDLSGIMITTVILEVNKSGDDIVSNLFRVQSLHPNTTYKINMKAVIIDRGLHGQQTDDLC
FRTAPGRPEPPTEVEILSRGLHFIELVWKTAINNGAFISHYHVYIHENELEDGRMMQTAE
EKIQISNLIPQTCYKIRIHSINALGESMEGYELDVWTKPNSPPLAPENISVFAQSHRSIR
VSWDKNPNCTIWIEVYNCASGKGGYARENFGGDQTVIGELDPDTEYQMRVIARNEFGEGH
SEYINMRTQKYRKSEHPSRFRQYSDDHRKVNYDRSPSTPFFVRFVDNCPEMAWKNFASPQ
DEISFLVEGSTFEMPEKYIQLYRGNSSSLIVLDSKMHYIRVINIFKKGQRSPPSERAVIP
REYFKYRPEKITDVKISLRSENCVLVKWQTLDIKSNKLPETSKIIYYVQRCDLTENQVLC
AGEEDHCFFDNIPGETTISVQVRAAVSFHDALTHGDWSVLSHFTTPRGLPSPVINAKFNV
KCSTLYWDCLDKSTDLQYTVHIRQLPTKRDLLKVTTKAKNIVLDSVQPGEKYSVTLISLT
TVGKSKQRTELEINVPALKPSAPEDVAVSQVQIDRCTVSWTAAEGNGSPIIGYVVRMMLN
GELFSEHFVTESENETNYRHVLKYLDPNTEYLINIAAKNSVGFSEKIEAVVKTVPLCPTI
PKIWCDCEATALKIHWDRVTSGNSMMYKLMKINKNAQQVTLYEGENNTAKVKSLKENTKY
VFKLRVSDRATGASTWSESFSFSTTTAPPPPLKKSPSTALVSGHSYLYRIEWENCLPDSS
QHYYRLQIADATVKGAKWQLCYEGRNHFYELNTETYPGALHVRVMCVRKHLEEELKGSPS
PVGYIGNVPPTIESVKNEEIHQKSRLHLFTTDRAYAYSLLVLLIFLFLMILSFSEKAFEY
ITGMPIEKLSSGNAATSPPSSKPPQ
NT seq 4398 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaagatgaattatccaatccggcagctgctgcaaacgagggtatacgtcaagag
ttttttaggaattttctgaaagccaccggtacgagtggcggagatatgaagaccctagaa
acattggacgatggcggctcgacgtcatcacatcaaacttctcctgagtacccgagccct
cctccgccaagcaattctcctcctgaatcaatggcatcccttcaggcagaatcaccgatt
gaggatgaggacgctcgtcatgaaatgacttcaacagaaggaacgtcttctactggaact
ggtagtccgcaagagcctaaaacatggatctctcagcccggttatcatccagtgcctatc
agtggtcctcttccacgtcatccacaatctattctatttgttcacgtgaatgatggagaa
attctacaactacatcaacaaggaaataacgaagttgttggaaatcttcttggtcctgga
acagttcgcatgattggtgaacccgggatgacaaaccaaccgcttccaattcaactccgc
cacaatcaacagtgccatcaatttgttgatgaagagggaaatctccgccatgttgtgttg
tcagtcgcttcgtcagataatagcggtcagagctcgcaggaactgaatgttccacagctt
gttggttctcaacaactgctcaatgctattggaggaactccaacacaaaacggtcctgga
acgtcatcttcacgaggaagtggccgaggaaatcatggtggaggacgaagaaattacgga
aatcagagaagtcttcatacgaacaacaacgaatcaggacaacacagtcaaaatgggcac
tctggacaccgtaatgtatattctcgtggcaactaccgcggcaataaatataattcaaga
ggtcgtatggattatcatggaaaagctcgtaacgataatcccagttacatggctaataac
gtgcaagagcttccggagctcgcagtgaatacacatggatcaattgattcaaatgttcaa
gtgacggcaagcacaactcaggatatggttacactaagacaaccaactccagttatgact
ttacctccaccaccacaacaaagatcgttactaggagaaccatctgggccaccaatgggt
gaaatgcaaccaattgtgcacggaataccgtctgcgcaatccgtaaacttccctccgcca
ggactcccattgttaataccaagtgttcacgagattccacggcaagatttaagcgttatg
cctgcaatgatgaatgggtccgtgcagtcaacaatgatgcaagatccaatgatgcccgga
acatcaatgggaatgaatccacagatgttcggtgttcctccacctcctccaggcatgatg
atattgtcgactgatgctgcctttaacaacaacaagtggataccatatcaaaccttgggg
gagaatgaacgtctactcaaagtactgtcgactttgcgtccaattagagttgccaacaca
ctcacaactgaaatggagtttctctatacgccgctgaaaataaatgactaccgattcgaa
cacggcatctgtttgttcggaccaattgaaaattcggatgtgtcttaccatgcaactgtg
tttgacttaagtggaataatgattaccactgttatcctggaagtgaacaaaagcggcgac
gacattgtgagcaatttgtttcgagtacagtctctacatcccaacacaacgtataaaatt
aatatgaaagctgtaattattgatcgaggacttcatggacaacaaacggatgatctatgc
ttccgcacagccccgggaaggccggaaccaccaacggaagttgagattctttcacgtggt
cttcattttattgagttggtatggaaaactgcaattaacaacggtgcattcatcagtcat
tatcatgtgtacattcacgagaatgagttggaagatggtcgtatgatgcaaacagccgag
gaaaagattcaaatttctaacttgattccacaaacgtgctataagattagaatccattca
atcaatgctctgggagaatcaatggaaggctatgaacttgatgtgtggacaaaaccaaac
tcaccgccgcttgccccggaaaacatttctgttttcgcacaatcacatcgatcgattcgt
gtcagttgggacaagaaccctaattgtactatctggattgaagtttacaattgtgcatca
ggaaagggtggatacgctcgggaaaactttggcggagatcagacagttattggagaactt
gacccagacacggaataccaaatgcgtgtcatcgctcgtaacgagtttggagaagggcat
tctgaatacatcaacatgagaacacagaagtaccgcaagagtgaacatccttcacgcttc
cgacagtatagcgatgatcatcgtaaggttaactatgatcgttcaccatctacaccattt
tttgtgcgttttgttgacaactgtccagaaatggcatggaaaaactttgcatcaccacaa
gacgaaatcagctttttagttgaaggatccacatttgaaatgccggaaaaatatattcag
ctctatagaggaaattcttcatcactcattgttttggatagtaaaatgcactatattcga
gtaataaacattttcaaaaaaggacaaagaagtccgccatcagaacgagctgtgattcct
cgtgaatactttaagtacagaccggagaaaattactgacgtgaaaatttctttgaggagt
gaaaattgtgtgctggttaaatggcaaacattggatatcaagtcaaacaaacttcccgag
acttcaaaaattatctactatgtgcaacgatgtgatcttacagaaaatcaagttttatgt
gcaggcgaagaagaccactgtttttttgataatattcctggagagaccacaatcagtgtc
caagtccgtgcggctgtgtccttccatgatgctttgactcatggcgattggagtgttctc
tctcatttcacaactccacgaggacttccttctccggttatcaacgctaagtttaatgtg
aaatgttcaactctctactgggattgcctagacaaatcaacggaccttcaatatacagta
cacattcgacagttgccaactaaacgggatcttcttaaagtgacaacaaaagcgaaaaac
attgtcttagatagtgttcaacctggagaaaagtattcagtgacacttatttctttgaca
acagttggtaaatcaaaacaacgtactgaactggaaatcaatgttcccgctttgaaacca
agtgccccagaagatgttgcagtgtcccaagtgcaaattgatagatgcactgtgtcatgg
acagcagcagaaggaaatggatcacccattatcggttacgttgttcgtatgatgttgaat
ggagaacttttcagtgagcattttgtgactgaaagcgaaaacgagacaaattaccgtcac
gtgctgaagtacttagatcccaacaccgagtacttgatcaatattgctgcaaagaactcg
gttggattcagtgaaaagattgaagctgttgtcaaaacagtcccactctgtccaactatt
ccaaaaatatggtgcgactgtgaagcgactgctcttaaaattcattgggatcgagtgaca
tcgggcaatagcatgatgtataaattgatgaaaattaacaaaaacgcgcaacaagtcaca
ttatatgagggagagaataatacagcaaaagtgaagagcttgaaagaaaacacgaaatat
gttttcaagctgcgagtttctgatcgagccactggggcttctacatggtccgagtcattc
tcattcagcacaacaactgctccaccaccgcccttgaaaaaaagcccatcgactgcactt
gtttccggccactcttacttgtaccgtattgaatgggaaaactgccttccagacagttca
caacattactacagacttcaaattgctgatgcgactgtaaagggagcaaagtggcaactg
tgttacgaaggaagaaatcacttctacgagttgaacaccgaaacatatcctggggcttta
catgttcgagtcatgtgcgtgcgcaaacatcttgaagaagaattgaaaggaagtccgagt
ccagttggctatattggaaatgttcctcctactatcgagtcggtaaagaacgaggaaatt
catcaaaaatctagattgcatcttttcacgacggatagagcatatgcgtattctctcttg
gttttgctcatttttctcttcttaatgattcttagcttttccgaaaaagcttttgaatat
atcactggaatgcctattgaaaagttgtcttcgggaaatgcggcaacatctcctccgtct
tcaaaaccccctcaataa

DBGET integrated database retrieval system