KEGG   Caenorhabditis elegans (nematode): CELE_C35D10.15Help
Entry
CELE_C35D10.15    CDS       T00019                                 

Gene name
clec-6
Definition
(RefSeq) C-type LECtin
Organism
cel  Caenorhabditis elegans (nematode)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lectin_C CUB
Motif
Other DBs
NCBI-GeneID: 183242
NCBI-ProteinID: NP_498023
WormBase: WBGene00016451
Ensembl: WBGene00016451
UniProt: Q95QR9
Position
III:complement(join(4885697..4886451,4886494..4886625,4886701..4886842,4887248..4887442))
Genome map
AA seq 407 aa AA seqDB search
MIKHLVVLSLFALSAFGAKPLVCTNGFTLINNKCLRLFSTPLGHSASKSKCMEYGATLVT
VKNAIENNSVSKIAASSSSSLWIGLYCFDSDVTKCMWDDSTGSAEMYNSFASGFPHVDIG
KCVYHFTQGFLGGKWLNGDCDTETRAFVCELTETLEDSCEYNYNGHCYSFHQPATFAQAQ
VICEQECGNLASIHSSNENRYLSSIISSLSNKNYYIGASWPSTSVLTWLDGSTSDYNNIS
PSSAHEGNCALLSSQEQWLSSPCTSSQPFVCKRSVGSQCFSTPPLVTITPTPPNPSSCNS
TLLMAPGKITSPNFPSNYGNNQFCSYHLSTLGSYRVALYFLTFTTEFFFDFVVVYDGDSA
SSPKMGNYSGSKNPFALTSTGNNMFVTFKSDHSNTFQGFDARFQSSV
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgataaagcatttagttgtcttgtcactttttgctctctctgcttttggagcaaaacca
ctggtttgcacaaatggattcacattaattaacaataaatgtctacgattgttttctaca
ccacttggtcactctgcttctaagagcaaatgtatggagtatggagcaacgcttgtcact
gttaagaatgcaattgaaaacaactctgtgtcaaaaattgctgccagttcgtcctcatca
ctctggattggtctttactgttttgacagtgacgtgaccaaatgcatgtgggatgattct
actggttctgctgaaatgtacaacagttttgcaagtggttttccacatgttgatattgga
aagtgtgtataccactttacacaaggtttcctgggtgggaaatggctgaatggagactgt
gacactgaaacgagagcatttgtctgtgaattgacagaaacgctggaagatagttgtgaa
tataactacaatggacattgctattcatttcaccaaccagctacttttgcacaagctcag
gttatttgtgagcaagagtgtggaaatcttgcatcaattcattcttcaaacgaaaaccga
tacttgagttcaattataagttcattatccaacaagaattattatatcggagcatcatgg
ccgtcaacttctgtgctcacatggttggatggttctacctctgattacaataacatcagt
ccatcgtctgctcacgaaggaaattgtgcacttctgtcaagccaagaacaatggcttagt
tccccttgtacctcctctcaacctttcgtatgtaaaagatcagtcggctctcagtgtttt
agcactccaccattagtaacaatcacacctacacccccaaatccatcatcctgtaactct
acacttctcatggcgcctggtaaaattacatctccaaacttcccaagtaactacggcaat
aatcaattctgctcttatcatctatcaacacttggatcttatcgcgtggctctctatttt
ttaacgtttacaactgaattcttttttgacttcgtagtggtatatgatggggattctgca
agcagcccaaaaatggggaactacagtggatcaaagaacccgtttgctttgacttcgact
ggaaacaatatgtttgtgacattcaaatcagatcatagtaacacttttcaaggattcgac
gctagatttcagtcttccgtataa

DBGET integrated database retrieval system