KEGG   Caenorhabditis elegans (nematode): CELE_C36A4.4
Entry
CELE_C36A4.4      CDS       T00019                                 

Symbol
C36A4.4
Name
(RefSeq) Probable UDP-N-acetylglucosamine pyrophosphorylase
  KO
K00972  UDP-N-acetylglucosamine/UDP-N-acetylgalactosamine diphosphorylase [EC:2.7.7.23 2.7.7.83]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel00520  Amino sugar and nucleotide sugar metabolism
cel01100  Metabolic pathways
cel01250  Biosynthesis of nucleotide sugars
Module
cel_M00892  UDP-N-acetyl-D-glucosamine biosynthesis, eukaryotes, glucose => UDP-GlcNAc
Brite
KEGG Orthology (KO) [BR:cel00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CELE_C36A4.4 (C36A4.4)
Enzymes [BR:cel01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.23  UDP-N-acetylglucosamine diphosphorylase
     CELE_C36A4.4 (C36A4.4)
    2.7.7.83  UDP-N-acetylgalactosamine diphosphorylase
     CELE_C36A4.4 (C36A4.4)
SSDB
Motif
Pfam: UDPGP NTP_transf_3
Other DBs
NCBI-GeneID: 175497
NCBI-ProteinID: NP_497777
WormBase: WBGene00007965
Ensembl: WBGene00007965
UniProt: Q18493
Position
III:complement(join(3841492..3841670,3841728..3841981,3842032..3842380,3842884..3843304,3843359..3843610))
AA seq 484 aa
MTITAPPKDEIISKFPGSEPLLNFYNELSDAEKSKLFHQISTLNLSEAHQWFIDSADQRA
PSTAEDLKPVLDSQHFVQAELHQVILDGLWNKGMDAIGRGEVCAIVLAGGQATRLGSSQP
KGTIPLGINASFGDSLLGIQAAKIALLQALAGEREHQNPGKIHWAVMTSPGTEEATREHV
KKLAAHHGFDFDEQITIFSQDEIAAYDEQGNFLLGTKGSVVAAPNGNGGLYSAISAHLPR
LRAKGIKYFHVYCVDNILCKVADPHFIGFAISNEADVATKCVPKQKGELVGSVCLDRGLP
RVVEYSELGAELAEQKTPDGKYLFGAGSIANHFFTMDFMDRVCSPSSRLPYHRAHKKISY
VNEQGTIVKPEKPNGIKLEQFIFDVFELSKRFFIWEVARNEEFSPLKNAQSVGTDCLSTC
QRDLSNVNKLWLERVQAKVTATEKPIYLKTIVSYNGENLQELRHREISDSALESDHSINK
FFVV
NT seq 1455 nt   +upstreamnt  +downstreamnt
atgaccatcactgctccaccaaaagacgagattatctcaaagtttccgggctctgagcca
cttctcaacttttacaatgagctctcggatgccgaaaaatcgaagcttttccaccaaatt
tcaactctaaacctttcggaagctcatcaatggttcattgattcagcggatcaacgggct
ccatcaactgcggaagaccttaagccggttcttgattctcagcattttgtacaagctgaa
ttgcatcaagtgatcctcgatggtctctggaacaagggaatggatgctattggacgtgga
gaagtatgtgcaattgtgctcgccggtggacaagctacacgtcttggatcaagtcaaccg
aaaggaacgattccattgggaattaacgcttcatttggagattctcttttgggaattcaa
gctgccaaaattgcacttcttcaggctctcgctggagaacgggagcatcagaatccggga
aaaattcactgggcagttatgacgtcacctggaacagaggaggctactcgtgagcatgtg
aagaaactggcggctcatcatggattcgatttcgatgaacaaattactattttctcacaa
gatgaaattgctgcatacgatgagcagggaaacttccttctcggaactaaaggatctgtt
gttgctgctccaaacggcaacggaggtctctactctgccatctctgctcatttgccacgt
cttcgcgcgaaaggaatcaaatatttccatgtgtattgtgtggacaacattctgtgcaaa
gttgccgaccctcatttcatcggattcgccatttcaaacgaagctgacgttgcaaccaag
tgtgttccgaagcaaaaaggagaactcgtcggatcagtttgtcttgatagaggactacca
cgtgtcgttgaatattcggagcttggagccgagttggctgaacaaaagacaccggatgga
aaatatttgtttggtgcaggatctattgcaaatcactttttcacgatggatttcatggat
agagtctgctctccatcatctcgtcttccatatcatcgtgctcacaagaagatttcctat
gtgaatgagcagggaaccattgtcaaaccggaaaaaccaaatggtatcaagctggagcag
tttattttcgacgtcttcgagctctcgaagcgatttttcatttgggaggtggcgaggaac
gaagagttttctccattgaaaaatgctcaatctgttggaactgattgtttgagcacttgt
cagagagatttgtccaatgtgaacaagttgtggctggaacgtgttcaagcgaaagtgact
gcaactgaaaagccgatctacttgaagacaattgtctcctacaacggagagaatcttcaa
gaactccgtcatcgtgaaatttctgatagtgccttggaatccgatcattcgattaacaaa
ttctttgttgtctag

DBGET integrated database retrieval system